Details of the Target
General Information of Target
| Target ID | LDTP14954 | |||||
|---|---|---|---|---|---|---|
| Target Name | Putative ATP-dependent RNA helicase TDRD12 (TDRD12) | |||||
| Gene Name | TDRD12 | |||||
| Gene ID | 91646 | |||||
| Synonyms |
ECAT8; Putative ATP-dependent RNA helicase TDRD12; EC 3.6.4.13; ES cell-associated transcript 8 protein; Tudor domain-containing protein 12 |
|||||
| 3D Structure | ||||||
| Sequence |
MSAKSKGNPSSSCPAEGPPAASKTKVKEQIKIIVEDLELVLGDLKDVAKELKEVVDQIDT
LTSDLQLEDEMTDSSKTDTLNSSSSGTTASSLEKIKVQANAPLIKPPAHPSAILTVLRKP NPPPPPPRLTPVKCEDPKRVVPTANPVKTNGTLLRNGGLPGGPNKIPNGDICCIPNSNLD KAPVQLLMHRPEKDRCPQAGPRERVRFNEKVQYHGYCPDCDTRYNIKNREVHLHSEPVHP PGKIPHQGPPLPPTPHLPPFPLENGGMGISHSNSFPPIRPATVPPPTAPKPQKTILRKST TTTV |
|||||
| Target Bioclass |
Enzyme
|
|||||
| Function |
Probable ATP-binding RNA helicase required during spermatogenesis to repress transposable elements and preventing their mobilization, which is essential for the germline integrity. Acts via the piRNA metabolic process, which mediates the repression of transposable elements during meiosis by forming complexes composed of piRNAs and Piwi proteins and governs the methylation and subsequent repression of transposons. Involved in the secondary piRNAs metabolic process. Acts via the PET complex, a multiprotein complex required during the secondary piRNAs metabolic process for the PIWIL2 slicing-triggered loading of PIWIL4 piRNAs.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
m-APA Probe Info |
![]() |
15.00 | LDD0402 | [1] | |
|
ONAyne Probe Info |
![]() |
N.A. | LDD0273 | [2] | |
|
DBIA Probe Info |
![]() |
C1097(6.69); C208(1.70) | LDD3343 | [3] | |
Competitor(s) Related to This Target
References



