Details of the Target
General Information of Target
| Target ID | LDTP14923 | |||||
|---|---|---|---|---|---|---|
| Target Name | Zinc finger protein 568 (ZNF568) | |||||
| Gene Name | ZNF568 | |||||
| Gene ID | 374900 | |||||
| Synonyms |
Zinc finger protein 568 |
|||||
| 3D Structure | ||||||
| Sequence |
MIGMLESLQHESDLLQHDQIHTGEKPYECNECRKTFSLKQNLVEHKKMHTGEKSHECTEC
GKVCSRVSSLTLHLRSHTGKKAYKCNKCGKAFSQKENFLSHQKHHTGEKPYECEKVSIQM PTIIRHQKNHTGTKPYACKECGKAFNGKAYLTEHEKIHTGEKPFECNQCGRAFSQKQYLI KHQNIHTGKKPFKCSECGKAFSQKENLIIHQRIHTGEKPYECKGCGKAFIQKSSLIRHQR SHTGEKPYTCKECGKAFSGKSNLTEHEKIHIGEKPYKCNECGTIFRQKQYLIKHHNIHTG EKPYECNKCGKAFSRITSLIVHVRIHTGDKPYECKVCGKAFCQSSSLTVHMRSHTGEKPY GCNECGKAFSQFSTLALHMRIHTGEKPYQCSECGKAFSQKSHHIRHQRIHTH |
|||||
| Target Bioclass |
Transcription factor
|
|||||
| Family |
Krueppel C2H2-type zinc-finger protein family
|
|||||
| Subcellular location |
Nucleus
|
|||||
| Function |
Has transcriptional repression activity, partially through the recruitment of the corepressor TRIM28 but has also repression activity independently of this interaction. Essential during embryonic development, where it acts as a direct repressor of a placental-specific transcript of IGF2 in early development and regulates convergent extension movements required for axis elongation and tissue morphogenesis in all germ layers. Also important for normal morphogenesis of extraembryonic tissues including the yolk sac, extraembryonic mesoderm and placenta. May enhance proliferation or maintenance of neural stem cells.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Target Site Mutations in Different Cell Lines
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
HHS-465 Probe Info |
![]() |
K276(0.00); K279(0.00); Y278(0.00) | LDD2240 | [1] | |

