Details of the Target
General Information of Target
| Target ID | LDTP14916 | |||||
|---|---|---|---|---|---|---|
| Target Name | Mitochondrial nicotinamide adenine dinucleotide transporter SLC25A52 (SLC25A52) | |||||
| Gene Name | SLC25A52 | |||||
| Gene ID | 147407 | |||||
| Synonyms |
MCART2; Mitochondrial nicotinamide adenine dinucleotide transporter SLC25A52; Mitochondrial NAD(+) transporter SLC25A52; Mitochondrial carrier triple repeat protein 2; Solute carrier family 25 member 52
|
|||||
| 3D Structure | ||||||
| Sequence |
MGTLSCDSTPRLATAPLGRRVTEGQIPETGLRKSCGTATLENGSGPGLYVLPSTVGFINH
DCTRVASPAYSLVRRPSEAPPQDTSPGPIYFLDPKVTRFGRSCTPAYSMQGRAKSRGPEV TPGPGAYSPEKVPPVRHRTPPAFTLGCRLPLKPLDTSAPAPNAYTMPPLWGSQIFTKPSS PSYTVVGRTPPARPPQDPAEIPGPGQYDSPDANTYRQRLPAFTMLGRPRAPRPLEETPGP GAHCPEQVTVNKARAPAFSMGIRHSKRASTMAATTPSRPAGHRLPGRCC |
|||||
| Target Bioclass |
Transporter and channel
|
|||||
| Family |
Mitochondrial carrier (TC 2.A.29) family
|
|||||
| Subcellular location |
Mitochondrion inner membrane
|
|||||
| Function |
Mitochondrial membrane carrier protein that mediates the import of NAD(+) into mitochondria. Compared to SLC25A51, SLC25A52-mediated transport is not essential for the import of NAD(+) in mitochondria. The transport mechanism, uniport or antiport, its electrogenicity and substrate selectivity, remain to be elucidated.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
DBIA Probe Info |
![]() |
C166(0.77) | LDD1492 | [1] | |
|
IPM Probe Info |
![]() |
N.A. | LDD2156 | [2] | |
Competitor(s) Related to This Target
References


