Details of the Target
General Information of Target
| Target ID | LDTP14878 | |||||
|---|---|---|---|---|---|---|
| Target Name | Prostate-associated microseminoprotein (MSMP) | |||||
| Gene Name | MSMP | |||||
| Gene ID | 692094 | |||||
| Synonyms |
PSMP; Prostate-associated microseminoprotein; PC3-secreted microprotein |
|||||
| 3D Structure | ||||||
| Sequence |
MALLALLLVVALPRVWTDANLTARQRDPEDSQRTDEGDNRVWCHVCERENTFECQNPRRC
KWTEPYCVIAAVKIFPRFFMVAKQCSAGCAAMERPKPEEKRFLLEEPMPFFYLKCCKIRY CNLEGPPINSSVFKEYAGSMGESCGGLWLAILLLLASIAAGLSLS |
|||||
| Target Bioclass |
Other
|
|||||
| Family |
Beta-microseminoprotein family
|
|||||
| Subcellular location |
Secreted
|
|||||
| Function |
Acts as a ligand for C-C chemokine receptor CCR2. Signals through binding and activation of CCR2 and induces a strong chemotactic response and mobilization of intracellular calcium ions. Exhibits a chemotactic activity for monocytes and lymphocytes but not neutrophils.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
DBIA Probe Info |
 |
C100(2.00) | LDD3373 | [1] | |
Competitor(s) Related to This Target