Details of the Target
General Information of Target
| Target ID | LDTP14874 | |||||
|---|---|---|---|---|---|---|
| Target Name | Retrotransposon Gag-like protein 8B (RTL8B) | |||||
| Gene Name | RTL8B | |||||
| Gene ID | 441518 | |||||
| Synonyms |
CXX1C; FAM127C; MAR8B; Retrotransposon Gag-like protein 8B; Mammalian retrotransposon derived protein 8B |
|||||
| 3D Structure | ||||||
| Sequence |
MGCRAASGLLPGVAVVLLLLLQSTQSVYIQYQGFRVQLESMKKLSDLEAQWAPSPRLQAQ
SLLPAVCHHPALPQDLQPVCASQEASSIFKTLRTIANDDCELCVNVACTGCL |
|||||
| Target Bioclass |
Other
|
|||||
| Family |
FAM127 family
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
STPyne Probe Info |
 |
K102(2.41); K9(9.76) | LDD0277 | [1] | |