Details of the Target
General Information of Target
| Target ID | LDTP14864 | |||||
|---|---|---|---|---|---|---|
| Target Name | U2 small nuclear ribonucleoprotein auxiliary factor 35 kDa subunit-related protein 1 (ZRSR2P1) | |||||
| Gene Name | ZRSR2P1 | |||||
| Synonyms |
U2AF1-RS1; U2AF1L1; U2AF1P; U2AF1RS1; U2AFBPL; ZRSR1; U2 small nuclear ribonucleoprotein auxiliary factor 35 kDa subunit-related protein 1; CCCH type zinc finger, RNA-binding motif and serine/arginine rich protein 1; U2(RNU2) small nuclear RNA auxiliary factor 1-like 1
|
|||||
| 3D Structure | ||||||
| Sequence |
MPKRKSPENTEGKDGSKVTKQEPTRRSARLSAKPAPPKPEPKPRKTSAKKEPGAKISRGA
KGKKEEKQEAGKEGTAPSENGETKAEEAQKTESVDNEGE |
|||||
| Target Bioclass |
Other
|
|||||
| Subcellular location |
Nucleus
|
|||||
| Uniprot ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
DBIA Probe Info |
 |
C331(1.99) | LDD3310 | [1] | |
|
BTD Probe Info |
 |
C265(2.50) | LDD2144 | [2] | |
|
IPM Probe Info |
 |
C177(1.39) | LDD1702 | [2] | |
Competitor(s) Related to This Target
| Competitor ID | Name | Cell line | Binding Site(Ratio) | Interaction ID | Ref |
|---|---|---|---|---|---|
| LDCM0213 | Electrophilic fragment 2 | MDA-MB-231 | C177(1.39) | LDD1702 | [2] |
| LDCM0022 | KB02 | 42-MG-BA | C331(1.62) | LDD2244 | [1] |
| LDCM0023 | KB03 | 769-P | C331(2.94); C265(3.10) | LDD2663 | [1] |
| LDCM0024 | KB05 | COLO792 | C331(1.99) | LDD3310 | [1] |
| LDCM0550 | Nucleophilic fragment 5a | MDA-MB-231 | C265(2.50) | LDD2144 | [2] |
References