Details of the Target
General Information of Target
| Target ID | LDTP14831 | |||||
|---|---|---|---|---|---|---|
| Target Name | Putative E3 ubiquitin-protein ligase makorin-4 (MKRN4P) | |||||
| Gene Name | MKRN4P | |||||
| Synonyms |
MKRN4; MKRNP5; RNF64; ZNF127L1; Putative E3 ubiquitin-protein ligase makorin-4; EC 2.3.2.27; Makorin RING finger protein pseudogene 4; Makorin RING finger protein pseudogene 5; RING finger protein 64; RING-type E3 ubiquitin transferase makorin-4; Zinc finger protein 127-Xp; ZNF127-Xp; Zinc finger protein 127-like 1
|
|||||
| 3D Structure | ||||||
| Sequence |
MNTLQGPVSFKDVAVDFTQEEWRQLDPDEKIAYGDVMLENYSHLVSVGYDYHQAKHHHGV
EVKEVEQGEEPWIMEGEFPCQHSPEPAKAIKPIDRKSVHQICSGPVVLSLSTAVKELVEN SLDAGATNIDLKLKDYGVDLIEVSDNGCGVEEENFEGLISFSSETSHM |
|||||
| Target Bioclass |
Enzyme
|
|||||
| Function | May act as a E3 ubiquitin ligase catalyzing the covalent attachment of ubiquitin moieties onto substrate proteins. | |||||
| Uniprot ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
DBIA Probe Info |
![]() |
C294(1.38) | LDD3339 | [1] | |
|
IA-alkyne Probe Info |
![]() |
N.A. | LDD0162 | [2] | |
Competitor(s) Related to This Target
References


