Details of the Target
General Information of Target
| Target ID | LDTP14796 | |||||
|---|---|---|---|---|---|---|
| Target Name | Small EDRK-rich factor 2 (SERF2) | |||||
| Gene Name | SERF2 | |||||
| Gene ID | 10169 | |||||
| Synonyms |
FAM2C; Small EDRK-rich factor 2; Gastric cancer-related protein VRG107; Protein 4F5-related; 4F5rel; h4F5rel |
|||||
| 3D Structure | ||||||
| Sequence |
MVRPYPLIYFLFLPLGACFPLLDRREPTDAMGGLGAGERWADLAMGPRPHSVWGSSRWLR
ASQPQALLVIARGLQTSGREHAGCRFRFGRQDEGSEATGFLPAAGEKTSGPLGNLAEELN GYSRKKGGFSFRFGRR |
|||||
| Target Bioclass |
Other
|
|||||
| Family |
SERF family
|
|||||
| Function |
Positive regulator of amyloid protein aggregation and proteotoxicity. Induces conformational changes in amyloid proteins, such as HTT, driving them into compact formations preceding the formation of aggregates.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
ATP probe Probe Info |
![]() |
N.A. | LDD0199 | [1] | |
|
ATP probe Probe Info |
![]() |
N.A. | LDD0035 | [2] | |
|
YN-1 Probe Info |
![]() |
D40(0.00); E42(0.00) | LDD0447 | [3] | |
References



