Details of the Target
General Information of Target
Target ID | LDTP14754 | |||||
---|---|---|---|---|---|---|
Target Name | Keratin-associated protein 10-12 (KRTAP10-12) | |||||
Gene Name | KRTAP10-12 | |||||
Gene ID | 386685 | |||||
Synonyms |
KAP10.12; KAP18-12; KRTAP10.12; KRTAP18-12; KRTAP18.12; Keratin-associated protein 10-12; High sulfur keratin-associated protein 10.12; Keratin-associated protein 10.12; Keratin-associated protein 18-12; Keratin-associated protein 18.12
|
|||||
3D Structure | ||||||
Sequence |
MATSTMSVCSSAYSDSWQVDACPESCCEPPCCATSCCAPAPCLTLVCTPVSCVSSPCCQA
ACEPSPCQSGCTSSCTPSCCQQSSCQPACCTSSPCQQACCVPVCCKPVCCVPVCCKPVCC KPICCVPVCSGASSSCCQQSSRQPACCTTSCCRPSSSVSLLCRPVCRSTCCVPIPSCCAP ASTCQPSCCRPASCVSLLCRPTCSRLSSACCGLSSGQKSSC |
|||||
Target Bioclass |
Other
|
|||||
Family |
KRTAP type 10 family
|
|||||
Function |
In the hair cortex, hair keratin intermediate filaments are embedded in an interfilamentous matrix, consisting of hair keratin-associated proteins (KRTAP), which are essential for the formation of a rigid and resistant hair shaft through their extensive disulfide bond cross-linking with abundant cysteine residues of hair keratins. The matrix proteins include the high-sulfur and high-glycine-tyrosine keratins.
|
|||||
Uniprot ID | ||||||
Ensemble ID | ||||||
HGNC ID |
Probe(s) Labeling This Target
ABPP Probe
Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
---|---|---|---|---|---|
IA-alkyne Probe Info |
![]() |
C199(6.88) | LDD0315 | [1] |
Competitor(s) Related to This Target