Details of the Target
General Information of Target
| Target ID | LDTP14727 | |||||
|---|---|---|---|---|---|---|
| Target Name | Inhibin beta E chain (INHBE) | |||||
| Gene Name | INHBE | |||||
| Gene ID | 83729 | |||||
| Synonyms |
Inhibin beta E chain; Activin beta-E chain |
|||||
| 3D Structure | ||||||
| Sequence |
MKITGGLLLLCTVVYFCSSSEAASLSPKKVDCSIYKKYPVVAIPCPITYLPVCGSDYITY
GNECHLCTESLKSNGRVQFLHDGSC |
|||||
| Target Bioclass |
Other
|
|||||
| Family |
TGF-beta family
|
|||||
| Subcellular location |
Secreted
|
|||||
| Function |
Inhibins and activins inhibit and activate, respectively, the secretion of follitropin by the pituitary gland. Inhibins/activins are involved in regulating a number of diverse functions such as hypothalamic and pituitary hormone secretion, gonadal hormone secretion, germ cell development and maturation, erythroid differentiation, insulin secretion, nerve cell survival, embryonic axial development or bone growth, depending on their subunit composition. Inhibins appear to oppose the functions of activins.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
DBIA Probe Info |
 |
C139(1.54) | LDD3377 | [1] | |
Competitor(s) Related to This Target