Details of the Target
General Information of Target
| Target ID | LDTP14705 | |||||
|---|---|---|---|---|---|---|
| Target Name | Calponin-1 (CNN1) | |||||
| Gene Name | CNN1 | |||||
| Gene ID | 1264 | |||||
| Synonyms |
Calponin-1; Basic calponin; Calponin H1, smooth muscle |
|||||
| 3D Structure | ||||||
| Sequence |
MDCRKMVRFSYSVIWIMAISKAFELGLVAGLGHQEFARPSRGDLAFRDDSIWPQEEPAIR
PRSSQRVLPMGIQHSKELNRTCCLNGGTCMLESFCACPPSFYGRNCEHDVRKENCGSVPH DTWLPKKCSLCKCWHGQLRCFPQAFLPGCDGLVMDEHLVASRTPELPPSARTTTFMLAGI CLSIQSYY |
|||||
| Target Bioclass |
Other
|
|||||
| Family |
Calponin family
|
|||||
| Function |
Thin filament-associated protein that is implicated in the regulation and modulation of smooth muscle contraction. It is capable of binding to actin, calmodulin and tropomyosin. The interaction of calponin with actin inhibits the actomyosin Mg-ATPase activity.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Target Site Mutations in Different Cell Lines
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
DBIA Probe Info |
![]() |
C61(1.35) | LDD3443 | [1] | |
|
HHS-475 Probe Info |
![]() |
Y268(0.84); Y189(0.88) | LDD0264 | [2] | |
|
HHS-465 Probe Info |
![]() |
Y189(7.96); Y268(6.25) | LDD2237 | [3] | |
Competitor(s) Related to This Target
| Competitor ID | Name | Cell line | Binding Site(Ratio) | Interaction ID | Ref |
|---|---|---|---|---|---|
| LDCM0116 | HHS-0101 | DM93 | Y268(0.84); Y189(0.88) | LDD0264 | [2] |
| LDCM0117 | HHS-0201 | DM93 | Y189(0.69); Y268(0.77) | LDD0265 | [2] |
| LDCM0118 | HHS-0301 | DM93 | Y189(0.72); Y268(0.82) | LDD0266 | [2] |
| LDCM0119 | HHS-0401 | DM93 | Y189(0.78); Y268(0.87) | LDD0267 | [2] |
| LDCM0120 | HHS-0701 | DM93 | Y268(0.85); Y189(1.01) | LDD0268 | [2] |
| LDCM0022 | KB02 | HuH-1 | C61(1.26) | LDD2374 | [1] |
| LDCM0023 | KB03 | HuH-1 | C61(3.13) | LDD2791 | [1] |
| LDCM0024 | KB05 | SNU-449 | C61(1.35) | LDD3443 | [1] |
References



