Details of the Target
General Information of Target
| Target ID | LDTP14660 | |||||
|---|---|---|---|---|---|---|
| Target Name | Cellular retinoic acid-binding protein 1 (CRABP1) | |||||
| Gene Name | CRABP1 | |||||
| Gene ID | 1381 | |||||
| Synonyms |
RBP5; Cellular retinoic acid-binding protein 1; Cellular retinoic acid-binding protein I; CRABP-I |
|||||
| 3D Structure | ||||||
| Sequence |
MSTKKSPEELKRIFEKYAAKEGDPDQLSKDELKLLIQAEFPSLLKGPNTLDDLFQELDKN
GDGEVSFEEFQVLVKKISQ |
|||||
| Target Bioclass |
Other
|
|||||
| Family |
Calycin superfamily, Fatty-acid binding protein (FABP) family
|
|||||
| Subcellular location |
Cytoplasm
|
|||||
| Function | Cytosolic CRABPs may regulate the access of retinoic acid to the nuclear retinoic acid receptors. | |||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
| ChEMBL ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
IA-alkyne Probe Info |
 |
N.A. | LDD0167 | [1] | |
|
NAIA_5 Probe Info |
 |
N.A. | LDD2223 | [2] | |
The Interaction Atlas With This Target
The Protein(s) Related To This Target
Transporter and channel
| Protein name | Family | Uniprot ID | |||
|---|---|---|---|---|---|
| Na(+)/H(+) exchange regulatory cofactor NHE-RF1 (NHERF1) | . | O14745 | |||
The Drug(s) Related To This Target
Approved
| Drug Name | Drug Type | External ID | |||
|---|---|---|---|---|---|
| Alitretinoin | Small molecular drug | DB00523 | |||
| Tretinoin | Small molecular drug | DB00755 | |||
Investigative
| Drug Name | Drug Type | External ID | |||
|---|---|---|---|---|---|
| Tamibarotene | Small molecular drug | DB04942 | |||
Discontinued
| Drug Name | Drug Type | External ID | |||
|---|---|---|---|---|---|
| Etretinate | Small molecular drug | DB00926 | |||
References