Details of the Target
General Information of Target
| Target ID | LDTP14655 | |||||
|---|---|---|---|---|---|---|
| Target Name | Small proline-rich protein 2D (SPRR2D) | |||||
| Gene Name | SPRR2D | |||||
| Gene ID | 6703 | |||||
| Synonyms |
Small proline-rich protein 2D; SPR-2D; Small proline-rich protein II; SPR-II |
|||||
| 3D Structure | ||||||
| Sequence |
MSYQQQQCKQPCQPPPVCPTPKCPEPCPPPKCPEPCPPPKCPQPCPPQQCQQKCPPVTPS
PPCQPKCPPKSK |
|||||
| Target Bioclass |
Other
|
|||||
| Family |
Cornifin (SPRR) family
|
|||||
| Subcellular location |
Cytoplasm
|
|||||
| Function |
Cross-linked envelope protein of keratinocytes. It is a keratinocyte protein that first appears in the cell cytosol, but ultimately becomes cross-linked to membrane proteins by transglutaminase. All that results in the formation of an insoluble envelope beneath the plasma membrane.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
DBIA Probe Info |
 |
C63(1.39) | LDD3413 | [1] | |
Competitor(s) Related to This Target