Details of the Target

General Information of Target

Target ID	LDTP14652
Target Name	Zinc finger protein 10 (ZNF10)
Gene Name	ZNF10
Gene ID	7556
Synonyms	KOX1; Zinc finger protein 10; Zinc finger protein KOX1
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
Sequence	MAKMNLSSYILILTFSLFSQGILLSASKSIRNLDDDMVFNTFRLGKGFQKEDTAEKSVIA PSLEQYKNDESSFMNEEENKVSKNTGSKHNFLNHGLPLNLAIKPYLALKGSVAFPAENGV QNTESTQEKREIGDEENSAKFPIGRRDFDMLRCMLGRVYRPCWQV
Target Bioclass	Transcription factor
Family	Krueppel C2H2-type zinc-finger protein family
Subcellular location	Nucleus
Function	May be involved in transcriptional regulation.
Uniprot ID	P21506
Ensemble ID	ENST00000248211.11
HGNC ID	HGNC:12879

Probe(s) Labeling This Target

ABPP Probe

Click To Hide/Show 1 Probe Related to This Target

Probe name		Structure	Binding Site(Ratio)	Interaction ID	Ref
Acrolein Probe Info			N.A.	LDD0217	[1]

Competitor(s) Related to This Target

Competitor ID	Name	Cell line	Binding Site(Ratio)	Interaction ID	Ref
LDCM0108	Chloroacetamide	HeLa	N.A.	LDD0222	[1]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Other

Click To Hide/Show 1 Protein(s) Interacting with This Target

Protein name				Family	Uniprot ID
Caspase recruitment domain-containing protein 10 (CARD10)				.	Q9BWT7

References

1	ACR-Based Probe for the Quantitative Profiling of Histidine Reactivity in the Human Proteome. J Am Chem Soc. 2023 Mar 8;145(9):5252-5260. doi: 10.1021/jacs.2c12653. Epub 2023 Feb 27.