Details of the Target
General Information of Target
| Target ID | LDTP14630 | |||||
|---|---|---|---|---|---|---|
| Target Name | Zinc finger protein 875 (ZNF875) | |||||
| Gene Name | ZNF875 | |||||
| Gene ID | 284459 | |||||
| Synonyms |
HKR1; Zinc finger protein 875; Krueppel-related zinc finger protein 1; Protein HKR1 |
|||||
| 3D Structure | ||||||
| Sequence |
MAASGGTKKAQSGGRRLREPSSRPSRRARQRPRRGALRKAGRFL
|
|||||
| Target Bioclass |
Transcription factor
|
|||||
| Family |
Krueppel C2H2-type zinc-finger protein family
|
|||||
| Subcellular location |
Nucleus
|
|||||
| Function | May be involved in transcriptional regulation. | |||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
IA-alkyne Probe Info |
 |
N.A. | LDD0167 | [1] | |