Details of the Target

General Information of Target

Target ID	LDTP14616
Target Name	Tripartite motif-containing protein 49 (TRIM49)
Gene Name	TRIM49
Gene ID	57093
Synonyms	RNF18; Tripartite motif-containing protein 49; RING finger protein 18; Testis-specific RING-finger protein
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
Sequence	MSDKPDLSEVEKFDRSKLKKTNTEEKNTLPSKETIQQEKECVQTS
Target Bioclass	Enzyme
Family	TRIM/RBCC family
Uniprot ID	P0CI25
Ensemble ID	ENST00000329758.5
HGNC ID	HGNC:13431

Probe(s) Labeling This Target

ABPP Probe

Click To Hide/Show 1 Probe Related to This Target

Probe name		Structure	Binding Site(Ratio)	Interaction ID	Ref
Acrolein Probe Info			N.A.	LDD0222	[1]

Competitor(s) Related to This Target

Competitor ID	Name	Cell line	Binding Site(Ratio)	Interaction ID	Ref
LDCM0108	Chloroacetamide	HeLa	N.A.	LDD0222	[1]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Enzyme

Click To Hide/Show 1 Protein(s) Interacting with This Target

Protein name				Family	Uniprot ID
Ubiquitin carboxyl-terminal hydrolase MINDY-3 (MINDY3)				MINDY deubiquitinase family	Q9H8M7

Transporter and channel

Click To Hide/Show 1 Protein(s) Interacting with This Target

Protein name				Family	Uniprot ID
Huntingtin (HTT)				Huntingtin family	P42858

Other

Click To Hide/Show 1 Protein(s) Interacting with This Target

Protein name				Family	Uniprot ID
Cyclin-dependent kinases regulatory subunit 1 (CKS1B)				CKS family	P61024

References

1	ACR-Based Probe for the Quantitative Profiling of Histidine Reactivity in the Human Proteome. J Am Chem Soc. 2023 Mar 8;145(9):5252-5260. doi: 10.1021/jacs.2c12653. Epub 2023 Feb 27.