Details of the Target
General Information of Target
| Target ID | LDTP14592 | |||||
|---|---|---|---|---|---|---|
| Target Name | Homeobox protein Hox-C6 (HOXC6) | |||||
| Gene Name | HOXC6 | |||||
| Gene ID | 3223 | |||||
| Synonyms |
HOX3C; Homeobox protein Hox-C6; Homeobox protein CP25; Homeobox protein HHO.C8; Homeobox protein Hox-3C |
|||||
| 3D Structure | ||||||
| Sequence |
MALSAEDRALVRALWKKLGSNVGVYTTEALERTFLAFPATKTYFSHLDLSPGSSQVRAHG
QKVADALSLAVERLDDLPHALSALSHLHACQLRVDPASFQLLGHCLLVTLARHYPGDFSP ALQASLDKFLSHVISALVSEYR |
|||||
| Target Bioclass |
Transcription factor
|
|||||
| Family |
Antp homeobox family
|
|||||
| Subcellular location |
Nucleus
|
|||||
| Function | Sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis. | |||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Target Site Mutations in Different Cell Lines
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
DBIA Probe Info |
![]() |
C97(1.33) | LDD3380 | [1] | |
Competitor(s) Related to This Target

