Details of the Target
General Information of Target
| Target ID | LDTP14533 | |||||
|---|---|---|---|---|---|---|
| Target Name | Brain mitochondrial carrier protein 1 (SLC25A14) | |||||
| Gene Name | SLC25A14 | |||||
| Gene ID | 9016 | |||||
| Synonyms |
BMCP1; UCP5; Brain mitochondrial carrier protein 1; BMCP-1; Mitochondrial uncoupling protein 5; UCP 5; Solute carrier family 25 member 14 |
|||||
| 3D Structure | ||||||
| Sequence |
MEWRNHSGRVSEFVLLGFPAPAPLQVLLFALLLLAYVLVLTENTLIIMAIRNHSTLHKPM
YFFLANMSFLEIWYVTVTIPKMLAGFVGSKQDHGQLISFEGCMTQLYFFLGLGCTECVLL AVMAYDRYMAICYPLHYPVIVSGRLCVQMAAGSWAGGFGISMVKVFLISGLSYCGPNIIN HFFCDVSPLLNLSCTDMSTAELTDFILAIFILLGPLSVTGASYVAITGAVMHIPSAAGRY KAFSTCASHLTVVIIFYAASIFIYARPKALSAFDTNKLVSVLYAVIVPLLNPIIYCLRNQ EVKRALCCTLHLYQHQDPDPKKASRNV |
|||||
| Target Bioclass |
Transporter and channel
|
|||||
| Family |
Mitochondrial carrier (TC 2.A.29) family
|
|||||
| Subcellular location |
Mitochondrion inner membrane
|
|||||
| Function |
Transports inorganic anions (sulfate, sulfite, thiosulfate and phosphate) and, to a lesser extent, a variety of dicarboxylates (e.g. malonate, malate and citramalate) and, even more so, aspartate and glutamate and tricarboxylates. May catalyze the export of sulfite and thiosulfate (the hydrogen sulfide degradation products) from the mitochondria, thereby modulating the level of the hydrogen sulfide (Probable). Also can mediate a very low unidirectional transport of anions including sulfate, phosphate, (S)-malate, citrate, L-aspartate and L-glutamate. Maintains oxidative balance (through uncoupling activities) and ATP production (by modifying mitochondrial membrane potential). Is able to transport protons across lipid membranes. Also exhibits transmembrane chloride transport activity to a lesser extent. May modify mitochondrial respiratory efficiency and mitochondrial oxidant production.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Target Site Mutations in Different Cell Lines
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
AOyne Probe Info |
![]() |
15.00 | LDD0443 | [1] | |

