Details of the Target
General Information of Target
Target ID | LDTP14527 | |||||
---|---|---|---|---|---|---|
Target Name | Serine protease 23 (PRSS23) | |||||
Gene Name | PRSS23 | |||||
Gene ID | 11098 | |||||
Synonyms |
ZSIG13; Serine protease 23; EC 3.4.21.-; Putative secreted protein Zsig13 |
|||||
3D Structure | ||||||
Sequence |
MDPEHCAPFRVGPAPGPYVASGDEPPGPQGTPAAAPHLHPAPPRGPRLTRFPACGPLEPY
LPEPAKPPAKYLQDLGPGPALNGGHFYEGPAEAEEKTSKAASFPQLPLDCRGGPRDGPSN LQGSPGPCLASLHLPLSPGLPDSMELAKNKSKKRRNRTTFSTFQLEELEKVFQKTHYPDV YAREQLALRTDLTEARVQVWFQNRRAKWRKRERYGKIQEGRNPFTAAYDISVLPRTDSHP QLQNSLWASPGSGSPGGPCLVSPEGIPSPCMSPYSHPHGSVAGFMGVPAPSAAHPGIYSI HGFPPTLGGHSFEPSSDGDYKSPSLVSLRVKPKEPPGLLNWTT |
|||||
Target Bioclass |
Enzyme
|
|||||
Family |
Peptidase S1 family
|
|||||
Subcellular location |
Secreted
|
|||||
Uniprot ID | ||||||
Ensemble ID | ||||||
HGNC ID |
Target Site Mutations in Different Cell Lines
Cell line | Mutation details | Probe for labeling this protein in this cell | |||
---|---|---|---|---|---|
AN3CA | SNV: p.T45A | . | |||
BXPC3 | SNV: p.E382D | . | |||
FUOV1 | SNV: p.L171I | DBIA Probe Info | |||
NCIH1792 | SNV: p.F12C | . | |||
OVCAR5 | SNV: p.R204Ter | DBIA Probe Info | |||
SUPT1 | Insertion: p.G141WfsTer60 | . | |||
SW1573 | SNV: p.Q344Ter | . |
Probe(s) Labeling This Target
ABPP Probe
Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
---|---|---|---|---|---|
OPA-S-S-alkyne Probe Info |
![]() |
K270(2.67); K189(2.74); K185(2.74); K331(4.02) | LDD3494 | [1] | |
DBIA Probe Info |
![]() |
C176(2.17); C370(3.18) | LDD3310 | [2] | |
IPM Probe Info |
![]() |
C380(0.72) | LDD1701 | [3] | |
Acrolein Probe Info |
![]() |
N.A. | LDD0232 | [4] | |
IA-alkyne Probe Info |
![]() |
C160(0.00); C176(0.00); C380(0.00); C370(0.00) | LDD0162 | [5] | |
NAIA_5 Probe Info |
![]() |
N.A. | LDD2223 | [6] |
Competitor(s) Related to This Target
Competitor ID | Name | Cell line | Binding Site(Ratio) | Interaction ID | Ref |
---|---|---|---|---|---|
LDCM0214 | AC1 | HEK-293T | C176(1.11) | LDD1507 | [7] |
LDCM0276 | AC17 | HEK-293T | C176(1.02) | LDD1515 | [7] |
LDCM0285 | AC25 | HEK-293T | C176(0.92) | LDD1524 | [7] |
LDCM0294 | AC33 | HEK-293T | C176(1.00) | LDD1533 | [7] |
LDCM0303 | AC41 | HEK-293T | C176(1.11) | LDD1542 | [7] |
LDCM0311 | AC49 | HEK-293T | C176(1.03) | LDD1550 | [7] |
LDCM0320 | AC57 | HEK-293T | C176(1.05) | LDD1559 | [7] |
LDCM0356 | AKOS034007680 | HEK-293T | C176(1.08) | LDD1570 | [7] |
LDCM0632 | CL-Sc | Hep-G2 | C176(20.00) | LDD2227 | [6] |
LDCM0404 | CL17 | HEK-293T | C176(1.19) | LDD1608 | [7] |
LDCM0417 | CL29 | HEK-293T | C176(0.99) | LDD1621 | [7] |
LDCM0431 | CL41 | HEK-293T | C176(0.99) | LDD1635 | [7] |
LDCM0440 | CL5 | HEK-293T | C176(1.08) | LDD1644 | [7] |
LDCM0444 | CL53 | HEK-293T | C176(1.12) | LDD1647 | [7] |
LDCM0457 | CL65 | HEK-293T | C176(1.10) | LDD1660 | [7] |
LDCM0470 | CL77 | HEK-293T | C176(1.13) | LDD1673 | [7] |
LDCM0483 | CL89 | HEK-293T | C176(1.08) | LDD1686 | [7] |
LDCM0022 | KB02 | 22RV1 | C370(2.29) | LDD2243 | [2] |
LDCM0023 | KB03 | MDA-MB-231 | C380(0.72) | LDD1701 | [3] |
LDCM0024 | KB05 | COLO792 | C176(2.17); C370(3.18) | LDD3310 | [2] |
LDCM0109 | NEM | HeLa | N.A. | LDD0232 | [4] |
The Interaction Atlas With This Target
References