Details of the Target
General Information of Target
| Target ID | LDTP14512 | |||||
|---|---|---|---|---|---|---|
| Target Name | C1q-related factor (C1QL1) | |||||
| Gene Name | C1QL1 | |||||
| Gene ID | 10882 | |||||
| Synonyms |
C1QRF; CRF; CTRP14; C1q-related factor; C1q and tumor necrosis factor-related protein 14; C1q/TNF-related protein 14; Complement component 1 Q subcomponent-like 1 |
|||||
| 3D Structure | ||||||
| Sequence |
MAQFVRNLVEKTPALVNAAVTYSKPRLATFWYYAKVELVPPTPAEIPRAIQSLKKIVNSA
QTGSFKQLTVKEAVLNGLVATEVLMWFYVGEIIGKRGIIGYDV |
|||||
| Target Bioclass |
Other
|
|||||
| Subcellular location |
Secreted
|
|||||
| Function | May regulate the number of excitatory synapses that are formed on hippocampus neurons. Has no effect on inhibitory synapses. | |||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
DBIA Probe Info |
 |
C32(4.52) | LDD3487 | [1] | |
Competitor(s) Related to This Target