Details of the Target
General Information of Target
| Target ID | LDTP14506 | |||||
|---|---|---|---|---|---|---|
| Target Name | Transcription elongation factor A protein 3 (TCEA3) | |||||
| Gene Name | TCEA3 | |||||
| Gene ID | 6920 | |||||
| Synonyms |
TFIISH; Transcription elongation factor A protein 3; Transcription elongation factor S-II protein 3; Transcription elongation factor TFIIS.h |
|||||
| 3D Structure | ||||||
| Sequence |
MTTQLRVVHLLPLLLACFVQTSPKQEKMKMDCHKDEKGTIYDYEAIALNKNEYVSFKQYV
GKHILFVNVATYCGLTAQYPELNALQEELKPYGLVVLGFPCNQFGKQEPGDNKEILPGLK YVRPGGGFVPSFQLFEKGDVNGEKEQKVFSFLKHSCPHPSEILGTFKSISWDPVKVHDIR WNFEKFLVGPDGIPVMRWSHRATVSSVKTDILAYLKQFKTK |
|||||
| Target Bioclass |
Other
|
|||||
| Family |
TFS-II family
|
|||||
| Subcellular location |
Nucleus
|
|||||
| Function |
Necessary for efficient RNA polymerase II transcription elongation past template-encoded arresting sites. The arresting sites in DNA have the property of trapping a certain fraction of elongating RNA polymerases that pass through, resulting in locked ternary complexes. Cleavage of the nascent transcript by S-II allows the resumption of elongation from the new 3'-terminus.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Target Site Mutations in Different Cell Lines
| Cell line | Mutation details | Probe for labeling this protein in this cell | |||
|---|---|---|---|---|---|
| HT115 | SNV: p.A96G | DBIA Probe Info | |||
| IGROV1 | SNV: p.A298T | . | |||
| NCIH1155 | SNV: p.T23M | DBIA Probe Info | |||
| SUPT1 | Deletion: p.K13SfsTer18 | . | |||
| TOV21G | SNV: p.Q289K | . | |||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
IPM Probe Info |
 |
C310(0.00); C212(0.00); C318(0.00); C191(0.00) | LDD0241 | [1] | |
|
DBIA Probe Info |
 |
C318(2.18); C310(1.59) | LDD3319 | [2] | |
|
BTD Probe Info |
 |
C191(0.73) | LDD2091 | [3] | |
|
IA-alkyne Probe Info |
 |
N.A. | LDD0167 | [4] | |
Competitor(s) Related to This Target
The Interaction Atlas With This Target
References