Details of the Target
General Information of Target
| Target ID | LDTP14447 | |||||
|---|---|---|---|---|---|---|
| Target Name | Monocarboxylate transporter 6 (SLC16A5) | |||||
| Gene Name | SLC16A5 | |||||
| Gene ID | 9121 | |||||
| Synonyms |
MCT5; MCT6; Monocarboxylate transporter 6; MCT 6; Monocarboxylate transporter 5; MCT 5; Solute carrier family 16 member 5 |
|||||
| 3D Structure | ||||||
| Sequence |
MVQQRGARAKRDGGPPPPGPGPAEEGAREPGWCKTPSGHIKRPMNAFMVWSQHERRKIMD
QWPDMHNAEISKRLGRRWQLLQDSEKIPFVREAERLRLKHMADYPDYKYRPRKKSKGAPA KARPRPPGGSGGGSRLKPGPQLPGRGGRRAAGGPLGGGAAAPEDDDEDDDEELLEVRLVE TPGRELWRMVPAGRAARGQAERAQGPSGEGAAAAAAASPTPSEDEEPEEEEEEAAAAEEG EEETVASGEESLGFLSRLPPGPAGLDCSALDRDPDLQPPSGTSHFEFPDYCTPEVTEMIA GDWRPSSIADLVFTY |
|||||
| Target Bioclass |
Transporter and channel
|
|||||
| Family |
Major facilitator superfamily, Monocarboxylate porter (TC 2.A.1.13) family
|
|||||
| Subcellular location |
Cell membrane
|
|||||
| Function |
Proton-linked monocarboxylate transporter. Catalyzes the rapid transport across the plasma membrane of many monocarboxylates such as lactate, pyruvate, branched-chain oxo acids derived from leucine, valine and isoleucine, and the ketone bodies acetoacetate, beta-hydroxybutyrate and acetate.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Target Site Mutations in Different Cell Lines
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
DBIA Probe Info |
 |
C474(1.37) | LDD2390 | [1] | |
Competitor(s) Related to This Target