Details of the Target
General Information of Target
Target ID | LDTP14436 | |||||
---|---|---|---|---|---|---|
Target Name | Tripartite motif-containing protein 66 (TRIM66) | |||||
Gene Name | TRIM66 | |||||
Gene ID | 9866 | |||||
Synonyms |
C11orf29; KIAA0298; Tripartite motif-containing protein 66 |
|||||
3D Structure | ||||||
Sequence |
MVTRFLGPRYRELVKNWVPTAYTWGAVGAVGLVWATDWRLILDWVPYINGKFKKDN
|
|||||
Target Bioclass |
Other
|
|||||
Subcellular location |
Nucleus
|
|||||
Function |
May function as transcription repressor; The repressive effects are mediated, at least in part, by recruitment of deacetylase activity. May play a role as negative regulator of postmeiotic genes acting through CBX3 complex formation and centromere association.
|
|||||
Uniprot ID | ||||||
HGNC ID | ||||||
ChEMBL ID |
Probe(s) Labeling This Target
ABPP Probe
Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
---|---|---|---|---|---|
NAIA_5 Probe Info |
![]() |
C1254(0.92) | LDD2227 | [1] |
Competitor(s) Related to This Target