Details of the Target
General Information of Target
| Target ID | LDTP14436 | |||||
|---|---|---|---|---|---|---|
| Target Name | Tripartite motif-containing protein 66 (TRIM66) | |||||
| Gene Name | TRIM66 | |||||
| Gene ID | 9866 | |||||
| Synonyms |
C11orf29; KIAA0298; Tripartite motif-containing protein 66 |
|||||
| 3D Structure | ||||||
| Sequence |
MVTRFLGPRYRELVKNWVPTAYTWGAVGAVGLVWATDWRLILDWVPYINGKFKKDN
|
|||||
| Target Bioclass |
Other
|
|||||
| Subcellular location |
Nucleus
|
|||||
| Function |
May function as transcription repressor; The repressive effects are mediated, at least in part, by recruitment of deacetylase activity. May play a role as negative regulator of postmeiotic genes acting through CBX3 complex formation and centromere association.
|
|||||
| Uniprot ID | ||||||
| HGNC ID | ||||||
| ChEMBL ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
NAIA_5 Probe Info |
![]() |
C1254(0.92) | LDD2227 | [1] | |
Competitor(s) Related to This Target

