Details of the Target
General Information of Target
| Target ID | LDTP14410 | |||||
|---|---|---|---|---|---|---|
| Target Name | PRKCH upstream open reading frame 2 (PRKCH) | |||||
| Gene Name | PRKCH | |||||
| Synonyms |
PRKCH upstream open reading frame 2; uORF2; Protein uPEP2 |
|||||
| 3D Structure | ||||||
| Sequence |
MALRSIKSIAGSCLCSRQRRCGSSAAIFPEGIFRCLSPKFGQEFPE
|
|||||
| Target Bioclass |
Other
|
|||||
| Function |
Product of an upstream open reading frame (ORF) of PRKCH which regulates translation of the downstream protein kinase C eta (PKC-eta) ORF. Functions as a repressive element that maintains low basal levels of PKC-eta in growing cells but enhances its expression during stress conditions induced by amino acid starvation in a EIF2AK4/GCN2-dependent manner. In addition to its role in regulating PKC-eta translation, also inhibits the kinase activity of PKC-eta as well as other protein kinases including PRKCD, PRKCQ and PRKCE but not PRKCA, PRKCG or PRKCZ.
|
|||||
| Uniprot ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
DBIA Probe Info |
 |
C301(1.48) | LDD3403 | [1] | |
Competitor(s) Related to This Target