Details of the Target
General Information of Target
| Target ID | LDTP14322 | |||||
|---|---|---|---|---|---|---|
| Target Name | HUWE1-associated protein modifying stress responses 2 (HAPSTR2) | |||||
| Gene Name | HAPSTR2 | |||||
| Gene ID | 389895 | |||||
| Synonyms |
HUWE1-associated protein modifying stress responses 2 |
|||||
| 3D Structure | ||||||
| Sequence |
DLKNVFPPKVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVSTDPQ
PLKEQPALNDSRYCLSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIV SAEAWGRADCGFTSESYQQGVLSATILYEILLGKATLYAVLVSALVLMAMVKRKDSRG |
|||||
| Target Bioclass |
Other
|
|||||
| Family |
HAPSTR1 family
|
|||||
| Subcellular location |
Nucleus
|
|||||
| Function |
Together with HAPSTR1 plays a central regulatory role in the cellular response to molecular stressors, such as DNA damage, nutrient scarcity, and protein misfolding. Regulates these multiple stress response signaling pathways by stabilizing HAPSTR1, but also independently of HAPSTR1.
|
|||||
| Uniprot ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
IA-alkyne Probe Info |
![]() |
N.A. | LDD0162 | [1] | |

