Details of the Target
General Information of Target
Target ID | LDTP14249 | |||||
---|---|---|---|---|---|---|
Target Name | COMM domain-containing protein 10 (COMMD10) | |||||
Gene Name | COMMD10 | |||||
Gene ID | 51397 | |||||
Synonyms |
COMM domain-containing protein 10 |
|||||
3D Structure | ||||||
Sequence |
MAVAAVKWVMSKRTILKHLFPVQNGALYCVCHKSTYSPLPDDYNCNVELALTSDGRTIVC
YHPSVDIPYEHTKPIPRPDPVHNNEETHDQVLKTRLEEKVEHLEEGPMIEQLSKMFFTTK HRWYPHGRYHRCRKNLNPPKDR |
|||||
Target Bioclass |
Other
|
|||||
Subcellular location |
Cytoplasm
|
|||||
Function | May modulate activity of cullin-RING E3 ubiquitin ligase (CRL) complexes. May down-regulate activation of NF-kappa-B. | |||||
Uniprot ID | ||||||
Ensemble ID | ||||||
HGNC ID |
Probe(s) Labeling This Target
ABPP Probe
Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
---|---|---|---|---|---|
STPyne Probe Info |
![]() |
K40(10.00) | LDD0277 | [1] | |
DBIA Probe Info |
![]() |
C132(2.77) | LDD3310 | [2] | |
IA-alkyne Probe Info |
![]() |
N.A. | LDD0162 | [3] | |
WYneN Probe Info |
![]() |
N.A. | LDD0021 | [4] | |
IPM Probe Info |
![]() |
N.A. | LDD0147 | [5] | |
TFBX Probe Info |
![]() |
N.A. | LDD0148 | [5] | |
NAIA_5 Probe Info |
![]() |
N.A. | LDD2223 | [6] |
Competitor(s) Related to This Target
The Interaction Atlas With This Target
The Protein(s) Related To This Target
Enzyme
Protein name | Family | Uniprot ID | |||
---|---|---|---|---|---|
Glycine amidinotransferase, mitochondrial (GATM) | Amidinotransferase family | P50440 | |||
Cytochrome b-c1 complex subunit 1, mitochondrial (UQCRC1) | Peptidase M16 family | P31930 |
Transporter and channel
Protein name | Family | Uniprot ID | |||
---|---|---|---|---|---|
Coiled-coil domain-containing protein 22 (CCDC22) | CCDC22 family | O60826 | |||
Coiled-coil domain-containing protein 93 (CCDC93) | CCDC93 family | Q567U6 |
Transcription factor
Protein name | Family | Uniprot ID | |||
---|---|---|---|---|---|
Protein c-Fos (FOS) | BZIP family | P01100 |
Other
Protein name | Family | Uniprot ID | |||
---|---|---|---|---|---|
COMM domain-containing protein 1 (COMMD1) | . | Q8N668 | |||
COMM domain-containing protein 5 (COMMD5) | . | Q9GZQ3 |
References