Details of the Target
General Information of Target
Target ID | LDTP14242 | |||||
---|---|---|---|---|---|---|
Target Name | NAD-dependent protein lipoamidase sirtuin-4, mitochondrial (SIRT4) | |||||
Gene Name | SIRT4 | |||||
Gene ID | 23409 | |||||
Synonyms |
SIR2L4; NAD-dependent protein lipoamidase sirtuin-4, mitochondrial; EC 2.3.1.-; NAD-dependent ADP-ribosyltransferase sirtuin-4; EC 2.4.2.-; NAD-dependent protein biotinylase sirtuin-4; EC 2.3.1.-; NAD-dependent protein deacetylase sirtuin-4; EC 2.3.1.286; Regulatory protein SIR2 homolog 4; SIR2-like protein 4
|
|||||
3D Structure | ||||||
Sequence |
MNKHQKPVLTGQRFKTRKRDEKEKFEPTVFRDTLVQGLNEAGDDLEAVAKFLDSTGSRLD
YRRYADTLFDILVAGSMLAPGGTRIDDGDKTKMTNHCVFSANEDHETIRNYAQVFNKLIR RYKYLEKAFEDEMKKLLLFLKAFSETEQTKLAMLSGILLGNGTLPATILTSLFTDSLVKE GIAASFAVKLFKAWMAEKDANSVTSSLRKANLDKRLLELFPVNRQSVDHFAKYFTDAGLK ELSDFLRVQQSLGTRKELQKELQERLSQECPIKEVVLYVKEEMKRNDLPETAVIGLLWTC IMNAVEWNKKEELVAEQALKHLKQYAPLLAVFSSQGQSELILLQKVQEYCYDNIHFMKAF QKIVVLFYKADVLSEEAILKWYKEAHVAKGKSVFLDQMKKFVEWLQNAEEESESEGEEN |
|||||
Target Bioclass |
Enzyme
|
|||||
Family |
Sirtuin family, Class II subfamily
|
|||||
Subcellular location |
Mitochondrion matrix
|
|||||
Function |
Acts as a NAD-dependent protein lipoamidase, biotinylase, deacetylase and ADP-ribosyl transferase. Catalyzes more efficiently removal of lipoyl- and biotinyl- than acetyl-lysine modifications. Inhibits the pyruvate dehydrogenase complex (PDH) activity via the enzymatic hydrolysis of the lipoamide cofactor from the E2 component, DLAT, in a phosphorylation-independent manner. Catalyzes the transfer of ADP-ribosyl groups onto target proteins, including mitochondrial GLUD1, inhibiting GLUD1 enzyme activity. Acts as a negative regulator of mitochondrial glutamine metabolism by mediating mono ADP-ribosylation of GLUD1: expressed in response to DNA damage and negatively regulates anaplerosis by inhibiting GLUD1, leading to block metabolism of glutamine into tricarboxylic acid cycle and promoting cell cycle arrest. In response to mTORC1 signal, SIRT4 expression is repressed, promoting anaplerosis and cell proliferation. Acts as a tumor suppressor. Also acts as a NAD-dependent protein deacetylase: mediates deacetylation of 'Lys-471' of MLYCD, inhibiting its activity, thereby acting as a regulator of lipid homeostasis. Does not seem to deacetylate PC. Controls fatty acid oxidation by inhibiting PPARA transcriptional activation. Impairs SIRT1-PPARA interaction probably through the regulation of NAD(+) levels. Down-regulates insulin secretion. {|HAMAP-Rule:MF_03161}.
|
|||||
Uniprot ID | ||||||
Ensemble ID | ||||||
HGNC ID | ||||||
ChEMBL ID |
Probe(s) Labeling This Target
ABPP Probe
Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
---|---|---|---|---|---|
VSF Probe Info |
![]() |
N.A. | LDD0007 | [1] |
The Interaction Atlas With This Target
The Protein(s) Related To This Target
Enzyme
Transporter and channel
Protein name | Family | Uniprot ID | |||
---|---|---|---|---|---|
ADP/ATP translocase 2 (SLC25A5) | Mitochondrial carrier (TC 2.A.29) family | P05141 |
References