Details of the Target
General Information of Target
| Target ID | LDTP14211 | |||||
|---|---|---|---|---|---|---|
| Target Name | KICSTOR complex protein kaptin (KPTN) | |||||
| Gene Name | KPTN | |||||
| Gene ID | 11133 | |||||
| Synonyms |
KICSTOR complex protein kaptin; Actin-associated protein 2E4 |
|||||
| 3D Structure | ||||||
| Sequence |
MAPPGPASALSTSAEPLSRSIFRKFLLMLCSLLTSLYVFYCLAERCQTLSGPVVGLSGGG
EEAGAPGGGVLAGGPRELAVWPAAAQRKRLLQLPQWRRRRPPAPRDDGEEAAWEEESPGL SGGPGGSGAGSTVAEAPPGTLALLLDEGSKQLPQAIIIGVKKGGTRALLEFLRVHPDVRA VGAEPHFFDRSYDKGLAWYRDLMPRTLDGQITMEKTPSYFVTREAPARISAMSKDTKLIV VVRDPVTRAISDYTQTLSKRPDIPTFESLTFKNRTAGLIDTSWSAIQIGIYAKHLEHWLR HFPIRQMLFVSGERLISDPAGELGRVQDFLGLKRIITDKHFYFNKTKGFPCLKKAEGSSR PHCLGKTKGRTHPEIDREVVRRLREFYRPFNLKFYQMTGHDFGWDG |
|||||
| Target Bioclass |
Other
|
|||||
| Subcellular location |
Lysosome membrane
|
|||||
| Function |
As part of the KICSTOR complex functions in the amino acid-sensing branch of the TORC1 signaling pathway. Recruits, in an amino acid-independent manner, the GATOR1 complex to the lysosomal membranes and allows its interaction with GATOR2 and the RAG GTPases. Functions upstream of the RAG GTPases and is required to negatively regulate mTORC1 signaling in absence of amino acids. In absence of the KICSTOR complex mTORC1 is constitutively localized to the lysosome and activated. The KICSTOR complex is also probably involved in the regulation of mTORC1 by glucose.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Target Site Mutations in Different Cell Lines
| Cell line | Mutation details | Probe for labeling this protein in this cell | |||
|---|---|---|---|---|---|
| AN3CA | SNV: p.V328A | . | |||
| DU145 | SNV: p.E175D | . | |||
| HS839T | SNV: p.A431D | . | |||
| HUH7 | SNV: p.D424H | DBIA Probe Info | |||
| JURLMK1 | SNV: p.E184G | . | |||
| LS123 | SNV: p.A434P | . | |||
| MOLT4 | SNV: p.E40G | . | |||
| SNU5 | SNV: p.F209S | . | |||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
DBIA Probe Info |
![]() |
C221(2.50) | LDD3335 | [1] | |
|
Acrolein Probe Info |
![]() |
N.A. | LDD0221 | [2] | |
|
4-Iodoacetamidophenylacetylene Probe Info |
![]() |
N.A. | LDD0038 | [3] | |
|
IA-alkyne Probe Info |
![]() |
N.A. | LDD0036 | [3] | |
|
Lodoacetamide azide Probe Info |
![]() |
N.A. | LDD0037 | [3] | |
|
NAIA_5 Probe Info |
![]() |
N.A. | LDD2223 | [4] | |
Competitor(s) Related to This Target
References






