Details of the Target
General Information of Target
| Target ID | LDTP14187 | |||||
|---|---|---|---|---|---|---|
| Target Name | Beta-1,3-galactosyltransferase 1 (B3GALT1) | |||||
| Gene Name | B3GALT1 | |||||
| Gene ID | 8708 | |||||
| Synonyms |
Beta-1,3-galactosyltransferase 1; Beta-1,3-GalTase 1; Beta3Gal-T1; Beta3GalT1; EC 2.4.1.86; UDP-galactose:beta-N-acetyl-glucosamine-beta-1,3-galactosyltransferase 1 |
|||||
| 3D Structure | ||||||
| Sequence |
MAEPLQPDPGAAEDAAAQAVETPGWKAPEDAGPQPGSYEIRHYGPAKWVSTSVESMDWDS
AIQTGFTKLNSYIQGKNEKEMKIKMTAPVTSYVEPGSGPFSESTITISLYIPSEQQFDPP RPLESDVFIEDRAEMTVFVRSFDGFSSAQKNQEQLLTLASILREDGKVFDEKVYYTAGYN SPVKLLNRNNEVWLIQKNEPTKENE |
|||||
| Target Bioclass |
Enzyme
|
|||||
| Family |
Glycosyltransferase 31 family
|
|||||
| Subcellular location |
Golgi apparatus membrane
|
|||||
| Function |
Beta-1,3-galactosyltransferase that transfers galactose from UDP-alpha-D-galactose to substrates with a terminal beta-N-acetylglucosamine (beta-GlcNAc) residue. Involved in the biosynthesis of the carbohydrate moieties of glycolipids and glycoproteins. Inactive towards substrates with terminal alpha-N-acetylglucosamine (alpha-GlcNAc) or alpha-N-acetylgalactosamine (alpha-GalNAc) residues.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
| ChEMBL ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
DBIA Probe Info |
![]() |
C167(1.22) | LDD1507 | [1] | |
Competitor(s) Related to This Target
| Competitor ID | Name | Cell line | Binding Site(Ratio) | Interaction ID | Ref |
|---|---|---|---|---|---|
| LDCM0214 | AC1 | HEK-293T | C167(1.22) | LDD1507 | [1] |
| LDCM0276 | AC17 | HEK-293T | C167(1.11) | LDD1515 | [1] |
| LDCM0285 | AC25 | HEK-293T | C167(1.28) | LDD1524 | [1] |
| LDCM0294 | AC33 | HEK-293T | C167(1.10) | LDD1533 | [1] |
| LDCM0303 | AC41 | HEK-293T | C167(1.15) | LDD1542 | [1] |
| LDCM0311 | AC49 | HEK-293T | C167(1.10) | LDD1550 | [1] |
| LDCM0320 | AC57 | HEK-293T | C167(1.45) | LDD1559 | [1] |
| LDCM0356 | AKOS034007680 | HEK-293T | C167(0.99) | LDD1570 | [1] |
| LDCM0404 | CL17 | HEK-293T | C167(1.24) | LDD1608 | [1] |
| LDCM0417 | CL29 | HEK-293T | C167(1.38) | LDD1621 | [1] |
| LDCM0431 | CL41 | HEK-293T | C167(1.14) | LDD1635 | [1] |
| LDCM0440 | CL5 | HEK-293T | C167(1.22) | LDD1644 | [1] |
| LDCM0444 | CL53 | HEK-293T | C167(0.99) | LDD1647 | [1] |
| LDCM0457 | CL65 | HEK-293T | C167(1.23) | LDD1660 | [1] |
| LDCM0470 | CL77 | HEK-293T | C167(1.37) | LDD1673 | [1] |
| LDCM0483 | CL89 | HEK-293T | C167(0.93) | LDD1686 | [1] |

