Details of the Target
General Information of Target
| Target ID | LDTP14151 | |||||
|---|---|---|---|---|---|---|
| Target Name | Doublesex- and mab-3-related transcription factor 2 (DMRT2) | |||||
| Gene Name | DMRT2 | |||||
| Gene ID | 10655 | |||||
| Synonyms |
DSXL2; Doublesex- and mab-3-related transcription factor 2; Doublesex-like 2 protein; DSXL-2 |
|||||
| 3D Structure | ||||||
| Sequence |
MELWGRMLWALLSGPGRRGSTRGWAFSSWQPQPPLAGLSSAIELVSHWTGVFEKRGIPEA
RESSEYIVAHVLGAKTFQSLRPALWTQPLTSQQLQCIRELSSRRLQRMPVQYILGEWDFQ GLSLRMVPPVFIPRPETEELVEWVLEEVAQRSHAVGSPGSPLILEVGCGSGAISLSLLSQ LPQSRVIAVDKREAAISLTHENAQRLRLQDRIWIIHLDMTSERSWTHLPWGPMDLIVSNP PYVFHQDMEQLAPEIRSYEDPAALDGGEEGMDIITHILALAPRLLKDSGSIFLEVDPRHP ELVSSWLQSRPDLYLNLVAVRRDFCGRPRFLHIRRSGP |
|||||
| Target Bioclass |
Transcription factor
|
|||||
| Family |
DMRT family
|
|||||
| Subcellular location |
Nucleus
|
|||||
| Function |
Transcriptional activator that directly regulates early activation of the myogenic determination gene MYF5 by binding in a sequence-specific manner to the early epaxial enhancer element of it. Involved in somitogenesis during embryogenesis and somite development and differentiation into sclerotome and dermomyotome. Required for the initiation and/or maintenance of proper organization of the sclerotome, dermomyotome and myotome.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Target Site Mutations in Different Cell Lines
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
DBIA Probe Info |
![]() |
C105(1.83) | LDD3410 | [1] | |
Competitor(s) Related to This Target

