Details of the Target
General Information of Target
| Target ID | LDTP14138 | |||||
|---|---|---|---|---|---|---|
| Target Name | Methyltransferase N6AMT1 (N6AMT1) | |||||
| Gene Name | N6AMT1 | |||||
| Gene ID | 29104 | |||||
| Synonyms |
C21orf127; HEMK2; KMT9; PRED28; Methyltransferase N6AMT1; HemK methyltransferase family member 2; M.HsaHemK2P; Lysine N-methyltransferase 9; EC 2.1.1.-; Methylarsonite methyltransferase N6AMT1; EC 2.1.1.-; Protein N(5)-glutamine methyltransferase; EC 2.1.1.-
|
|||||
| 3D Structure | ||||||
| Sequence |
MERAPPDGPLNASGALAGEAAAAGGARGFSAAWTAVLAALMALLIVATVLGNALVMLAFV
ADSSLRTQNNFFLLNLAISDFLVGAFCIPLYVPYVLTGRWTFGRGLCKLWLVVDYLLCTS SAFNIVLISYDRFLSVTRAVSYRAQQGDTRRAVRKMLLVWVLAFLLYGPAILSWEYLSGG SSIPEGHCYAEFFYNWYFLITASTLEFFTPFLSVTFFNLSIYLNIQRRTRLRLDGAREAA GPEPPPEAQPSPPPPPGCWGCWQKGHGEAMPLHRYGVGEAAVGAEAGEATLGGGGGGGSV ASPTSSSGSSSRGTERPRSLKRGSKPSASSASLEKRMKMVSQSFTQRFRLSRDRKVAKSL AVIVSIFGLCWAPYTLLMIIRAACHGHCVPDYWYETSFWLLWANSAVNPVLYPLCHHSFR RAFTKLLCPQKLKIQPHSSLEHCWK |
|||||
| Target Bioclass |
Enzyme
|
|||||
| Family |
Eukaryotic/archaeal PrmC-related family
|
|||||
| Subcellular location |
Nucleus
|
|||||
| Function |
Methyltransferase that can methylate proteins and, to a lower extent, arsenic. Catalytic subunit of a heterodimer with TRMT112, which monomethylates 'Lys-12' of histone H4 (H4K12me1), a modification present at the promoters of numerous genes encoding cell cycle regulators. Catalytic subunit of a heterodimer with TRMT112, which catalyzes N5-methylation of Glu residue of proteins with a Gly-Gln-Xaa-Xaa-Xaa-Arg motif. Methylates ETF1 on 'Gln-185'; ETF1 needs to be complexed to ERF3 in its GTP-bound form to be efficiently methylated. May also play a role in the modulation of arsenic-induced toxicity by mediating the conversion of monomethylarsonous acid (3+) into the less toxic dimethylarsonic acid. It however only plays a limited role in arsenic metabolism compared with AS3MT.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Target Site Mutations in Different Cell Lines
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
STPyne Probe Info |
![]() |
K189(0.31) | LDD0277 | [1] | |
|
5E-2FA Probe Info |
![]() |
N.A. | LDD2235 | [2] | |
|
m-APA Probe Info |
![]() |
N.A. | LDD2231 | [2] | |
|
NAIA_5 Probe Info |
![]() |
N.A. | LDD2223 | [3] | |
References




