Details of the Target
General Information of Target
| Target ID | LDTP14135 | |||||
|---|---|---|---|---|---|---|
| Target Name | Ectonucleoside triphosphate diphosphohydrolase 2 (ENTPD2) |
|
||||
| Gene Name | ENTPD2 | |||||
| Gene ID | 954 | |||||
| Synonyms |
CD39L1; Ectonucleoside triphosphate diphosphohydrolase 2; NTPDase 2; EC 3.6.1.-; CD39 antigen-like 1; Ecto-ATP diphosphohydrolase 2; Ecto-ATPDase 2; Ecto-ATPase 2 |
|||||
| 3D Structure | ||||||
| Sequence |
MKHVLNLYLLGVVLTLLSIFVRVMESLEGLLESPSPGTSWTTRSQLANTEPTKGLPDHPS
RSM |
|||||
| Target Bioclass |
Enzyme
|
|||||
| Family |
GDA1/CD39 NTPase family
|
|||||
| Subcellular location |
Multi-pass membrane protein; Endoplasmic reticulum membrane; Cell membrane
|
|||||
| Function |
In the nervous system, could hydrolyze ATP and other nucleotides to regulate purinergic neurotransmission. Hydrolyzes ADP only to a marginal extent. The order of activity with different substrates is ATP > GTP > CTP = ITP > UTP >> ADP = UDP.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
| ChEMBL ID | ||||||
Target Site Mutations in Different Cell Lines
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
DBIA Probe Info |
 |
C242(2.78) | LDD3389 | [1] | |
|
NAIA_5 Probe Info |
 |
C323(0.00); C399(0.00); C310(0.00) | LDD2223 | [2] | |
Competitor(s) Related to This Target
References