Details of the Target
General Information of Target
Target ID | LDTP14102 | |||||
---|---|---|---|---|---|---|
Target Name | Centrosomal protein of 83 kDa (CEP83) | |||||
Gene Name | CEP83 | |||||
Gene ID | 51134 | |||||
Synonyms |
CCDC41; Centrosomal protein of 83 kDa; Cep83; Coiled-coil domain-containing protein 41; Renal carcinoma antigen NY-REN-58 |
|||||
3D Structure | ||||||
Sequence |
MIKFFLMVNKQGQTRLSKYYEHVDINKRTLLETEVIKSCLSRSNEQCSFIEYKDFKLIYR
QYAALFIVVGVNDTENEMAIYEFIHNFVEVLDEYFSRVSELDIMFNLDKVHIILDEMVLN GCIVETNRARILAPLLILDKMSES |
|||||
Target Bioclass |
Other
|
|||||
Family |
CEP83 family
|
|||||
Subcellular location |
Cytoplasm, cytoskeleton, microtubule organizing center, centrosome, centriole
|
|||||
Function |
Component of the distal appendage region of the centriole involved in the initiation of primary cilium assembly. May collaborate with IFT20 in the trafficking of ciliary membrane proteins from the Golgi complex to the cilium during the initiation of primary cilium assembly.
|
|||||
Uniprot ID | ||||||
Ensemble ID | ||||||
HGNC ID |
Target Site Mutations in Different Cell Lines
Probe(s) Labeling This Target
ABPP Probe
Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
---|---|---|---|---|---|
IA-alkyne Probe Info |
![]() |
N.A. | LDD0166 | [1] | |
TFBX Probe Info |
![]() |
N.A. | LDD0148 | [2] |
The Interaction Atlas With This Target
The Protein(s) Related To This Target
Enzyme
Transporter and channel
Protein name | Family | Uniprot ID | |||
---|---|---|---|---|---|
Leucine zipper putative tumor suppressor 1 (LZTS1) | LZTS family | Q9Y250 |
Transcription factor
Protein name | Family | Uniprot ID | |||
---|---|---|---|---|---|
Cyclic AMP-dependent transcription factor ATF-4 (ATF4) | BZIP family | P18848 |
Other
Protein name | Family | Uniprot ID | |||
---|---|---|---|---|---|
CAP-Gly domain-containing linker protein 3 (CLIP3) | . | Q96DZ5 |
References