Details of the Target
General Information of Target
| Target ID | LDTP14029 | |||||
|---|---|---|---|---|---|---|
| Target Name | WD repeat domain phosphoinositide-interacting protein 4 (WDR45) | |||||
| Gene Name | WDR45 | |||||
| Gene ID | 11152 | |||||
| Synonyms |
WDRX1; WDRXI4; WIPI4; WD repeat domain phosphoinositide-interacting protein 4; WIPI-4; WD repeat-containing protein 45 |
|||||
| 3D Structure | ||||||
| Sequence |
MRDSTGAGNSLVHKRSPLRRNQKTPTSLTKLSLQDGHKAKKPACKFEEGQDVLARWSDGL
FYLGTIKKINILKQSCFIIFEDSSKSWVLWKDIQTGATGSGEMVCTICQEEYSEAPNEMV ICDKCGQGYHQLCHTPHIDSSVIDSDEKWLCRQCVFATTTKRGGALKKGPNAKALQVMKQ TLPYSVADLEWDAGHKTNVQQCYCYCGGPGDWYLKMLQCCKCKQWFHEACVQCLQKPMLF GDRFYTFICSVCSSGPEYLKRLPLQWVDIAHLCLYNLSVIHKKKYFDSELELMTYINENW DRLHPGELADTPKSERYEHVLEALNDYKTMFMSGKEIKKKKHLFGLRIRVPPVPPNVAFK AEKEPEGTSHEFKIKGRKASKPISDSREVSNGIEKKGKKKSVGRPPGPYTRKMIQKTAEP LLDKESISENPTLDLPCSIGRTEGTAHSSNTSDVDFTGASSAKETTSSSISRHYGLSDSR KRTRTGRSWPAAIPHLRRRRGRLPRRALQTQNSEIVKDDEGKEDYQFDELNTEILNNLAD QELQLNHLKNSITSYFGAAGRIACGEKYRVLARRVTLDGKVQYLVEWEGATAS |
|||||
| Target Bioclass |
Other
|
|||||
| Family |
WD repeat PROPPIN family
|
|||||
| Subcellular location |
Preautophagosomal structure
|
|||||
| Function |
Component of the autophagy machinery that controls the major intracellular degradation process by which cytoplasmic materials are packaged into autophagosomes and delivered to lysosomes for degradation. Binds phosphatidylinositol 3-phosphate (PtdIns3P). Activated by the STK11/AMPK signaling pathway upon starvation, WDR45 is involved in autophagosome assembly downstream of WIPI2, regulating the size of forming autophagosomes. Together with WIPI1, promotes ATG2 (ATG2A or ATG2B)-mediated lipid transfer by enhancing ATG2-association with phosphatidylinositol 3-monophosphate (PI3P)-containing membranes. Probably recruited to membranes through its PtdIns3P activity.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
Acrolein Probe Info |
![]() |
N.A. | LDD0222 | [1] | |
|
DBIA Probe Info |
![]() |
C166(0.90) | LDD1571 | [2] | |
Competitor(s) Related to This Target
| Competitor ID | Name | Cell line | Binding Site(Ratio) | Interaction ID | Ref |
|---|---|---|---|---|---|
| LDCM0108 | Chloroacetamide | HeLa | N.A. | LDD0222 | [1] |
| LDCM0367 | CL1 | HEK-293T | C166(0.90) | LDD1571 | [2] |
| LDCM0370 | CL101 | HEK-293T | C166(0.95) | LDD1574 | [2] |
| LDCM0374 | CL105 | HEK-293T | C166(0.84) | LDD1578 | [2] |
| LDCM0378 | CL109 | HEK-293T | C166(0.81) | LDD1582 | [2] |
| LDCM0383 | CL113 | HEK-293T | C166(0.99) | LDD1587 | [2] |
| LDCM0387 | CL117 | HEK-293T | C166(0.91) | LDD1591 | [2] |
| LDCM0392 | CL121 | HEK-293T | C166(0.97) | LDD1596 | [2] |
| LDCM0396 | CL125 | HEK-293T | C166(1.05) | LDD1600 | [2] |
| LDCM0400 | CL13 | HEK-293T | C166(0.87) | LDD1604 | [2] |
| LDCM0413 | CL25 | HEK-293T | C166(0.95) | LDD1617 | [2] |
| LDCM0426 | CL37 | HEK-293T | C166(0.88) | LDD1630 | [2] |
| LDCM0439 | CL49 | HEK-293T | C166(0.94) | LDD1643 | [2] |
| LDCM0453 | CL61 | HEK-293T | C166(0.91) | LDD1656 | [2] |
| LDCM0466 | CL73 | HEK-293T | C166(0.85) | LDD1669 | [2] |
| LDCM0479 | CL85 | HEK-293T | C166(0.90) | LDD1682 | [2] |
| LDCM0492 | CL97 | HEK-293T | C166(0.93) | LDD1695 | [2] |
The Interaction Atlas With This Target
References


