Details of the Target

General Information of Target

Target ID LDTP13949
Target Name Plasmolipin (PLLP)
Gene Name PLLP
Gene ID 51090
Synonyms
PMLP; TM4SF11; Plasmolipin; Plasma membrane proteolipid
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MATARPPWMWVLCALITALLLGVTEHVLANNDVSCDHPSNTVPSGSNQDLGAGAGEDARS
DDSSSRIINGSDCDMHTQPWQAALLLRPNQLYCGAVLVHPQWLLTAAHCRKKVFRVRLGH
YSLSPVYESGQQMFQGVKSIPHPGYSHPGHSNDLMLIKLNRRIRPTKDVRPINVSSHCPS
AGTKCLVSGWGTTKSPQVHFPKVLQCLNISVLSQKRCEDAYPRQIDDTMFCAGDKAGRDS
CQGDSGGPVVCNGSLQGLVSWGDYPCARPNRPGVYTNLCKFTKWIQETIQANS
Target Bioclass
Other
Family
MAL family
Subcellular location
Membrane
Function
Appears to be involved in myelination. Could also participate in ion transport events as addition of plasmolipin to lipid bilayers induces the formation of ion channels, which are voltage-dependent and K(+)-selective.
Uniprot ID
Q9Y342
Ensemble ID
ENST00000219207.10
HGNC ID
HGNC:18553

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 1 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
YN-1
 Probe Info  		100.00  LDD0444  [1]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Enzyme
Click To Hide/Show 9 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Palmitoyltransferase ZDHHC15 (ZDHHC15) DHHC palmitoyltransferase family Q96MV8
3-beta-hydroxysteroid-Delta(8),Delta(7)-isomerase (EBP) EBP family Q15125
Very long chain fatty acid elongase 4 (ELOVL4) ELO family Q9GZR5
Probable glutathione peroxidase 8 (GPX8) Glutathione peroxidase family Q8TED1
Vesicle transport protein GOT1A (GOLT1A) GOT1 family Q6ZVE7
Transmembrane protein with metallophosphoesterase domain (TMPPE) LOC643853 family Q6ZT21
GTP-binding protein SAR1a (SAR1A) SAR1 family Q9NR31
Tripartite motif-containing protein 59 (TRIM59) TRIM/RBCC family Q8IWR1
RING finger protein 122 (RNF122) . Q9H9V4
Transporter and channel
Click To Hide/Show 10 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Sodium-dependent organic anion transporter (SLC10A6) Bile acid:sodium symporter (BASS) family Q3KNW5
Membrane-associated progesterone receptor component 2 (PGRMC2) Cytochrome b5 family O15173
G protein-activated inward rectifier potassium channel 2 (KCNJ6) Inward rectifier-type potassium channel family P48051
LHFPL tetraspan subfamily member 5 protein (LHFPL5) LHFP family Q8TAF8
Aquaporin-6 (AQP6) MIP/aquaporin (TC 1.A.8) family Q13520
Membrane-spanning 4-domains subfamily A member 12 (MS4A12) MS4A family Q9NXJ0
Proton-activated chloride channel (PACC1) Proton-activated chloride channel family Q9H813
Stimulator of interferon genes protein (STING1) STING family Q86WV6
Transmembrane protein 14B (TMEM14B) TMEM14 family Q9NUH8
Transmembrane protein 174 (TMEM174) . Q8WUU8
Transcription factor
Click To Hide/Show 1 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Homeobox protein Hox-A1 (HOXA1) Antp homeobox family P49639
Immunoglobulin
Click To Hide/Show 1 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
T-cell immunoreceptor with Ig and ITIM domains (TIGIT) . Q495A1
Cytokine and receptor
Click To Hide/Show 1 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Tumor necrosis factor ligand superfamily member 14 (TNFSF14) Tumor necrosis factor family O43557
Other
Click To Hide/Show 12 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Bcl-2-like protein 13 (BCL2L13) Bcl-2 family Q9BXK5
Claudin-14 (CLDN14) Claudin family O95500
Cysteine-rich tail protein 1 (CYSRT1) CYSRT1 family A8MQ03
Endoplasmic reticulum-Golgi intermediate compartment protein 3 (ERGIC3) ERGIC family Q9Y282
Membrane protein FAM174A (FAM174A) FAM174 family Q8TBP5
Progranulin (GRN) Granulin family P28799
Keratin, type I cuticular Ha4 (KRT34) Intermediate filament family O76011
Protein kish-B (TMEM167B) KISH family Q9NRX6
Keratin-associated protein 9-2 (KRTAP9-2) KRTAP type 9 family Q9BYQ4
Vacuolar ATPase assembly integral membrane protein VMA21 (VMA21) VMA21 family Q3ZAQ7
Fibroblast growth factor receptor substrate 3 (FRS3) . O43559
Fibronectin type III domain-containing protein 9 (FNDC9) . Q8TBE3

References

1 Ynamide Electrophile for the Profiling of Ligandable Carboxyl Residues in Live Cells and the Development of New Covalent Inhibitors. J Med Chem. 2022 Aug 11;65(15):10408-10418. doi: 10.1021/acs.jmedchem.2c00272. Epub 2022 Jul 26.