Details of the Target
General Information of Target
| Target ID | LDTP13934 | |||||
|---|---|---|---|---|---|---|
| Target Name | Krueppel-like factor 13 (KLF13) | |||||
| Gene Name | KLF13 | |||||
| Gene ID | 51621 | |||||
| Synonyms |
BTEB3; NSLP1; Krueppel-like factor 13; Basic transcription element-binding protein 3; BTE-binding protein 3; Novel Sp1-like zinc finger transcription factor 1; RANTES factor of late activated T-lymphocytes 1; RFLAT-1; Transcription factor BTEB3; Transcription factor NSLP1
|
|||||
| 3D Structure | ||||||
| Sequence |
MQCLLLLPFLLLGTVSALHLENDAPHLESLETQADLGQDLDSSKEQERDLALTEEVIQAE
GEEVKASACQDNFEDEEAMESDPAALDKDFQCPREEDIVEVQGSPRCKICRYLLVRTPKT FAEAQNVCSRCYGGNLVSIHDFNFNYRIQCCTSTVNQAQVWIGGNLRGWFLWKRFCWTDG SHWNFAYWSPGQPGNGQGSCVALCTKGGYWRRAQCDKQLPFVCSF |
|||||
| Target Bioclass |
Transcription factor
|
|||||
| Family |
Sp1 C2H2-type zinc-finger protein family
|
|||||
| Subcellular location |
Nucleus
|
|||||
| Function |
Represses transcription by binding to the BTE site, a GC-rich DNA element, in competition with the activator SP1. It also represses transcription by interacting with the corepressor Sin3A and HDAC1. Activates RANTES expression in T-cells.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
Phosphinate-6 Probe Info |
![]() |
N.A. | LDD0018 | [1] | |
The Interaction Atlas With This Target

