Details of the Target
General Information of Target
| Target ID | LDTP13911 | |||||
|---|---|---|---|---|---|---|
| Target Name | Y-box-binding protein 2 (YBX2) | |||||
| Gene Name | YBX2 | |||||
| Gene ID | 51087 | |||||
| Synonyms |
CSDA3; MSY2; Y-box-binding protein 2; Contrin; DNA-binding protein C; Dbpc; Germ cell-specific Y-box-binding protein; MSY2 homolog |
|||||
| 3D Structure | ||||||
| Sequence |
MSQQNTSGDCLFDGVNELMKTLQFAVHIPTFVLGLLLNLLAIHGFSTFLKNRWPDYAATS
IYMINLAVFDLLLVLSLPFKMVLSQVQSPFPSLCTLVECLYFVSMYGSVFTICFISMDRF LAIRYPLLVSHLRSPRKIFGICCTIWVLVWTGSIPIYSFHGKVEKYMCFHNMSDDTWSAK VFFPLEVFGFLLPMGIMGFCCSRSIHILLGRRDHTQDWVQQKACIYSIAASLAVFVVSFL PVHLGFFLQFLVRNSFIVECRAKQSISFFLQLSMCFSNVNCCLDVFCYYFVIKEFRMNIR AHRPSRVQLVLQDTTISRG |
|||||
| Target Bioclass |
Transcription factor
|
|||||
| Subcellular location |
Cytoplasm
|
|||||
| Function |
Major constituent of messenger ribonucleoprotein particles (mRNPs). Involved in the regulation of the stability and/or translation of germ cell mRNAs. Binds to Y-box consensus promoter element. Binds to full-length mRNA with high affinity in a sequence-independent manner. Binds to short RNA sequences containing the consensus site 5'-UCCAUCA-3' with low affinity and limited sequence specificity. Its binding with maternal mRNAs is necessary for its cytoplasmic retention. May mark specific mRNAs (those transcribed from Y-box promoters) in the nucleus for cytoplasmic storage, thereby linking transcription and mRNA storage/translational delay.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
DBIA Probe Info |
![]() |
C224(2.52) | LDD3331 | [1] | |
|
NAIA_5 Probe Info |
![]() |
N.A. | LDD2225 | [2] | |
Competitor(s) Related to This Target
References


