Details of the Target
General Information of Target
| Target ID | LDTP13903 | |||||
|---|---|---|---|---|---|---|
| Target Name | Tyrosine-protein phosphatase non-receptor type 22 (PTPN22) | |||||
| Gene Name | PTPN22 | |||||
| Gene ID | 26191 | |||||
| Synonyms |
PTPN8; Tyrosine-protein phosphatase non-receptor type 22; EC 3.1.3.48; Hematopoietic cell protein-tyrosine phosphatase 70Z-PEP; Lymphoid phosphatase; LyP; PEST-domain phosphatase; PEP |
|||||
| 3D Structure | ||||||
| Sequence |
MASSGAGDPLDSKRGEAPFAQRIDPTREKLTPEQLHSMRQAELAQWQKVLPRRRTRNIVT
GLGIGALVLAIYGYTFYSISQERFLDELEDEAKAARARALARASGS |
|||||
| Target Bioclass |
Enzyme
|
|||||
| Family |
Protein-tyrosine phosphatase family, Non-receptor class 4 subfamily
|
|||||
| Subcellular location |
Cytoplasm
|
|||||
| Function |
Acts as a negative regulator of T-cell receptor (TCR) signaling by direct dephosphorylation of the Src family kinases LCK and FYN, ITAMs of the TCRz/CD3 complex, as well as ZAP70, VAV, VCP and other key signaling molecules. Associates with and probably dephosphorylates CBL. Dephosphorylates LCK at its activating 'Tyr-394' residue. Dephosphorylates ZAP70 at its activating 'Tyr-493' residue. Dephosphorylates the immune system activator SKAP2. Positively regulates toll-like receptor (TLR)-induced type 1 interferon production. Promotes host antiviral responses mediated by type 1 interferon. Regulates NOD2-induced pro-inflammatory cytokine secretion and autophagy. Acts as an activator of NLRP3 inflammasome assembly by mediating dephosphorylation of 'Tyr-861' of NLRP3. Dephosphorylates phospho-anandamide (p-AEA), an endocannabinoid to anandamide (also called N-arachidonoylethanolamide).
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
| ChEMBL ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
IA-alkyne Probe Info |
![]() |
C763(20.00) | LDD1706 | [1] | |
|
SF Probe Info |
![]() |
N.A. | LDD0028 | [2] | |
Competitor(s) Related to This Target
| Competitor ID | Name | Cell line | Binding Site(Ratio) | Interaction ID | Ref |
|---|---|---|---|---|---|
| LDCM0573 | Fragment11 | Ramos | C425(0.17) | LDD2190 | [3] |
| LDCM0576 | Fragment14 | Ramos | C425(0.90) | LDD2193 | [3] |
| LDCM0586 | Fragment28 | Ramos | C425(1.84) | LDD2198 | [3] |
| LDCM0566 | Fragment4 | Ramos | C425(1.57) | LDD2184 | [3] |
| LDCM0569 | Fragment7 | Ramos | C425(0.74) | LDD2186 | [3] |
| LDCM0022 | KB02 | Ramos | C425(1.06) | LDD2182 | [3] |
| LDCM0023 | KB03 | Ramos | C425(1.04) | LDD2183 | [3] |
| LDCM0024 | KB05 | T cell-activated | C763(20.00) | LDD1706 | [1] |
The Interaction Atlas With This Target
The Protein(s) Related To This Target
Enzyme
Transporter and channel
| Protein name | Family | Uniprot ID | |||
|---|---|---|---|---|---|
| T-cell surface glycoprotein CD3 zeta chain (CD247) | CD3Z/FCER1G family | P20963 | |||
Other
References


