Details of the Target
General Information of Target
Target ID | LDTP13861 | |||||
---|---|---|---|---|---|---|
Target Name | Phospholipid-transporting ATPase IF (ATP11B) | |||||
Gene Name | ATP11B | |||||
Gene ID | 23200 | |||||
Synonyms |
ATPIF; ATPIR; KIAA0956; Phospholipid-transporting ATPase IF; EC 7.6.2.1; ATPase IR; ATPase class VI type 11B; P4-ATPase flippase complex alpha subunit ATP11B |
|||||
3D Structure | ||||||
Sequence |
MEKKECPEKSSSSEEELPRRDSGSSRNIDASKLIRLQGSRKLLVDNSIRELQYTKTGIFF
QAEACVTNDTVYRELPCVSETLCDISHFFQEDDETEAEPLLFRAVPECQLSGGDIPSVSE EQESSEGQDSGDICSEENQIVSSYASKVCFEIEEDYKNRQFLGPEGNVDVELIDKSTNRY SVWFPTAGWYLWSATGLGFLVRDEVTVTIAFGSWSQHLALDLQHHEQWLVGGPLFDVTAE PEEAVAEIHLPHFISLQAGEVDVSWFLVAHFKNEGMVLEHPARVEPFYAVLESPSFSLMG ILLRIASGTRLSIPITSNTLIYYHPHPEDIKFHLYLVPSDALLTKAIDDEEDRFHGVRLQ TSPPMEPLNFGSSYIVSNSANLKVMPKELKLSYRSPGEIQHFSKFYAGQMKEPIQLEITE KRHGTLVWDTEVKPVDLQLVAASAPPPFSGAAFVKENHRQLQARMGDLKGVLDDLQDNEV LTENEKELVEQEKTRQSKNEALLSMVEKKGDLALDVLFRSISERDPYLVSYLRQQNL |
|||||
Target Bioclass |
Enzyme
|
|||||
Family |
Cation transport ATPase (P-type) (TC 3.A.3) family, Type IV subfamily
|
|||||
Subcellular location |
Recycling endosome membrane
|
|||||
Function |
Catalytic component of a P4-ATPase flippase complex which catalyzes the hydrolysis of ATP coupled to the transport of aminophospholipids, phosphatidylserines (PS) and phosphatidylethanolamines (PE), from the outer to the inner leaflet of intracellular membranes. May contribute to the maintenance of membrane lipid asymmetry in endosome compartment.
|
|||||
Uniprot ID | ||||||
Ensemble ID | ||||||
HGNC ID |
Probe(s) Labeling This Target
ABPP Probe
Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
---|---|---|---|---|---|
IPM Probe Info |
![]() |
N.A. | LDD0241 | [1] | |
DBIA Probe Info |
![]() |
C422(1.80) | LDD3310 | [2] | |
IA-alkyne Probe Info |
![]() |
C787(0.00); C792(0.00); C793(0.00) | LDD2241 | [3] | |
Lodoacetamide azide Probe Info |
![]() |
C787(0.00); C792(0.00); C793(0.00) | LDD0037 | [3] | |
TFBX Probe Info |
![]() |
N.A. | LDD0148 | [4] |
Competitor(s) Related to This Target
Competitor ID | Name | Cell line | Binding Site(Ratio) | Interaction ID | Ref |
---|---|---|---|---|---|
LDCM0372 | CL103 | HEK-293T | C741(0.84) | LDD1576 | [5] |
LDCM0376 | CL107 | HEK-293T | C741(0.92) | LDD1580 | [5] |
LDCM0381 | CL111 | HEK-293T | C741(0.88) | LDD1585 | [5] |
LDCM0385 | CL115 | HEK-293T | C741(0.91) | LDD1589 | [5] |
LDCM0389 | CL119 | HEK-293T | C741(0.87) | LDD1593 | [5] |
LDCM0394 | CL123 | HEK-293T | C741(1.18) | LDD1598 | [5] |
LDCM0398 | CL127 | HEK-293T | C741(0.95) | LDD1602 | [5] |
LDCM0402 | CL15 | HEK-293T | C741(1.11) | LDD1606 | [5] |
LDCM0415 | CL27 | HEK-293T | C741(0.82) | LDD1619 | [5] |
LDCM0418 | CL3 | HEK-293T | C741(0.92) | LDD1622 | [5] |
LDCM0428 | CL39 | HEK-293T | C741(0.95) | LDD1632 | [5] |
LDCM0455 | CL63 | HEK-293T | C741(0.92) | LDD1658 | [5] |
LDCM0481 | CL87 | HEK-293T | C741(1.04) | LDD1684 | [5] |
LDCM0494 | CL99 | HEK-293T | C741(0.83) | LDD1697 | [5] |
LDCM0495 | E2913 | HEK-293T | C741(1.22) | LDD1698 | [5] |
LDCM0468 | Fragment33 | HEK-293T | C741(0.94) | LDD1671 | [5] |
LDCM0022 | KB02 | DEL | C422(1.72) | LDD2315 | [2] |
LDCM0023 | KB03 | DEL | C422(1.84) | LDD2732 | [2] |
LDCM0024 | KB05 | COLO792 | C422(1.80) | LDD3310 | [2] |
The Interaction Atlas With This Target
References