Details of the Target
General Information of Target
| Target ID | LDTP13842 | |||||
|---|---|---|---|---|---|---|
| Target Name | Ribitol-5-phosphate xylosyltransferase 1 (RXYLT1) | |||||
| Gene Name | RXYLT1 | |||||
| Gene ID | 10329 | |||||
| Synonyms |
TMEM5; Ribitol-5-phosphate xylosyltransferase 1; EC 2.4.2.61; Transmembrane protein 5; UDP-D-xylose:ribitol-5-phosphate beta1,4-xylosyltransferase |
|||||
| 3D Structure | ||||||
| Sequence |
MKGWGWLALLLGALLGTAWARRSQDLHCGACRALVDELEWEIAQVDPKKTIQMGSFRINP
DGSQSVVEVPYARSEAHLTELLEEICDRMKEYGEQIDPSTHRKNYVRVVGRNGESSELDL QGIRIDSDISGTLKFACESIVEEYEDELIEFFSREADNVKDKLCSKRTDLCDHALHISHD EL |
|||||
| Target Type |
Literature-reported
|
|||||
| Target Bioclass |
Enzyme
|
|||||
| Family |
RXYLT1 family
|
|||||
| Subcellular location |
Golgi apparatus membrane
|
|||||
| Function |
Acts as a UDP-D-xylose:ribitol-5-phosphate beta1,4-xylosyltransferase, which catalyzes the transfer of UDP-D-xylose to ribitol 5-phosphate (Rbo5P) to form the Xylbeta1-4Rbo5P linkage on O-mannosyl glycan (Probable). Participates in the biosynthesis of the phosphorylated O-mannosyl trisaccharide (N-acetylgalactosamine-beta-3-N-acetylglucosamine-beta-4-(phosphate-6-)mannose), a carbohydrate structure present in alpha-dystroglycan (DAG1), which is required for binding laminin G-like domain-containing extracellular proteins with high affinity (Probable).
|
|||||
| TTD ID | ||||||
| Uniprot ID | ||||||
| DrugMap ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
DBIA Probe Info |
 |
C298(4.28) | LDD3311 | [1] | |
Competitor(s) Related to This Target