Details of the Target
General Information of Target
| Target ID | LDTP13821 | |||||
|---|---|---|---|---|---|---|
| Target Name | Type 2 lactosamine alpha-2,3-sialyltransferase (ST3GAL6) | |||||
| Gene Name | ST3GAL6 | |||||
| Gene ID | 10402 | |||||
| Synonyms |
SIAT10; Type 2 lactosamine alpha-2,3-sialyltransferase; EC 2.4.99.-; CMP-NeuAc:beta-galactoside alpha-2,3-sialyltransferase VI; ST3Gal VI; ST3GalVI; Sialyltransferase 10 |
|||||
| 3D Structure | ||||||
| Sequence |
MKLAAMIKKMCPSDSELSIPAKNCYRMVILGSSKVGKTAIVSRFLTGRFEDAYTPTIEDF
HRKFYSIRGEVYQLDILDTSGNHPFPAMRRLSILTGDVFILVFSLDNRDSFEEVQRLRQQ ILDTKSCLKNKTKENVDVPLVICGNKGDRDFYREVDQREIEQLVGDDPQRCAYFEISAKK NSSLDQMFRALFAMAKLPSEMSPDLHRKVSVQYCDVLHKKALRNKKLLRAGSGGGGGDPG DAFGIVAPFARRPSVHSDLMYIREKASAGSQAKDKERCVIS |
|||||
| Target Bioclass |
Enzyme
|
|||||
| Family |
Glycosyltransferase 29 family
|
|||||
| Subcellular location |
Golgi apparatus membrane
|
|||||
| Function |
Involved in the synthesis of sialyl-paragloboside, a precursor of sialyl-Lewis X determinant. Has a alpha-2,3-sialyltransferase activity toward Gal-beta1,4-GlcNAc structure on glycoproteins and glycolipids. Has a restricted substrate specificity, it utilizes Gal-beta1,4-GlcNAc on glycoproteins, and neolactotetraosylceramide and neolactohexaosylceramide, but not lactotetraosylceramide, lactosylceramide or asialo-GM1.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Target Site Mutations in Different Cell Lines
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
DBIA Probe Info |
![]() |
C118(2.74) | LDD3428 | [1] | |
Competitor(s) Related to This Target

