Details of the Target
General Information of Target
| Target ID | LDTP13811 | |||||
|---|---|---|---|---|---|---|
| Target Name | Choline/ethanolamine kinase (CHKB) | |||||
| Gene Name | CHKB | |||||
| Gene ID | 1120 | |||||
| Synonyms |
CHETK; CHKL; Choline/ethanolamine kinase; Choline kinase beta; CK; CKB; EC 2.7.1.32; Choline kinase-like protein; Ethanolamine kinase; EK; EC 2.7.1.82; Ethanolamine kinase beta; EKB; choline/ethanolamine kinase beta; CKEKB
|
|||||
| 3D Structure | ||||||
| Sequence |
MMGLSLASAVLLASLLSLHLGTATRGSDISKTCCFQYSHKPLPWTWVRSYEFTSNSCSQR
AVIFTTKRGKKVCTHPRKKWVQKYISLLKTPKQL |
|||||
| Target Bioclass |
Enzyme
|
|||||
| Family |
Choline/ethanolamine kinase family
|
|||||
| Function | Has a key role in phospholipid metabolism, and catalyzes the first step of phosphatidylethanolamine and phosphatidylcholine biosynthesis. | |||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
| ChEMBL ID | ||||||
Target Site Mutations in Different Cell Lines
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
DBIA Probe Info |
![]() |
C28(1.67) | LDD3360 | [1] | |
|
NAIA_5 Probe Info |
![]() |
N.A. | LDD2223 | [2] | |
Competitor(s) Related to This Target
References


