Details of the Target
General Information of Target
| Target ID | LDTP13794 | |||||
|---|---|---|---|---|---|---|
| Target Name | Deleted in lung and esophageal cancer protein 1 (DLEC1) | |||||
| Gene Name | DLEC1 | |||||
| Gene ID | 9940 | |||||
| Synonyms |
DLC1; Deleted in lung and esophageal cancer protein 1; Deleted in lung cancer protein 1; DLC-1 |
|||||
| 3D Structure | ||||||
| Sequence |
MPPKGKSGSGKAGKGGAASGSDSADKKAQGPKGGGNAVKVRHILCEKHGKIMEAMEKLKS
GMRFNEVAAQYSEDKARQGGDLGWMTRGSMVGPFQEAAFALPVSGMDKPVFTDPPVKTKF GYHIIMVEGRK |
|||||
| Target Bioclass |
Other
|
|||||
| Subcellular location |
Cytoplasm
|
|||||
| Function | Essential for spermatogenesis and male fertility. May play an important role in sperm head and tail formation. May act as a tumor suppressor by inhibiting cell proliferation. | |||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Target Site Mutations in Different Cell Lines
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
ONAyne Probe Info |
![]() |
K292(8.33) | LDD0274 | [1] | |
|
Methacrolein Probe Info |
![]() |
N.A. | LDD0218 | [2] | |
|
W1 Probe Info |
![]() |
N.A. | LDD0236 | [3] | |
References



