Details of the Target
General Information of Target
Target ID | LDTP13756 | |||||
---|---|---|---|---|---|---|
Target Name | Aurora kinase C (AURKC) | |||||
Gene Name | AURKC | |||||
Gene ID | 6795 | |||||
Synonyms |
AIE2; AIK3; AIRK3; ARK3; STK13; Aurora kinase C; EC 2.7.11.1; Aurora 3; Aurora/IPL1-related kinase 3; ARK-3; Aurora-related kinase 3; Aurora/IPL1/Eg2 protein 2; Serine/threonine-protein kinase 13; Serine/threonine-protein kinase aurora-C
|
|||||
3D Structure | ||||||
Sequence |
MSLSRSEEMHRLTENVYKTIMEQFNPSLRNFIAMGKNYEKALAGVTYAAKGYFDALVKMG
ELASESQGSKELGDVLFQMAEVHRQIQNQLEEMLKSFHNELLTQLEQKVELDSRYLSAAL KKYQTEQRSKGDALDKCQAELKKLRKKSQGSKNPQKYSDKELQYIDAISNKQGELENYVS DGYKTALTEERRRFCFLVEKQCAVAKNSAAYHSKGKELLAQKLPLWQQACADPSKIPERA VQLMQQVASNGATLPSALSASKSNLVISDPIPGAKPLPVPPELAPFVGRMSAQESTPIMN GVTGPDGEDYSPWADRKAAQPKSLSPPQSQSKLSDSYSNTLPVRKSVTPKNSYATTENKT LPRSSSMAAGLERNGRMRVKAIFSHAAGDNSTLLSFKEGDLITLLVPEARDGWHYGESEK TKMRGWFPFSYTRVLDSDGSDRLHMSLQQGKSSSTGNLLDKDDLAIPPPDYGAASRAFPA QTASGFKQRPYSVAVPAFSQGLDDYGARSMSRNPFAHVQLKPTVTNDRCDLSAQGPEGRE HGDGSARTLAGR |
|||||
Target Type |
Clinical trial
|
|||||
Target Bioclass |
Enzyme
|
|||||
Family |
Protein kinase superfamily, Ser/Thr protein kinase family, Aurora subfamily
|
|||||
Subcellular location |
Nucleus
|
|||||
Function |
Serine/threonine-protein kinase component of the chromosomal passenger complex (CPC), a complex that acts as a key regulator of mitosis. The CPC complex has essential functions at the centromere in ensuring correct chromosome alignment and segregation and is required for chromatin-induced microtubule stabilization and spindle assembly. Also plays a role in meiosis and more particularly in spermatogenesis. Has redundant cellular functions with AURKB and can rescue an AURKB knockdown. Like AURKB, AURKC phosphorylates histone H3 at 'Ser-10' and 'Ser-28'. AURKC phosphorylates the CPC complex subunits BIRC5/survivin and INCENP leading to increased AURKC activity. Phosphorylates TACC1, another protein involved in cell division, at 'Ser-228'.
|
|||||
TTD ID | ||||||
Uniprot ID | ||||||
DrugMap ID | ||||||
Ensemble ID | ||||||
HGNC ID | ||||||
ChEMBL ID |
Target Site Mutations in Different Cell Lines
Cell line | Mutation details | Probe for labeling this protein in this cell | |||
---|---|---|---|---|---|
COLO678 | SNV: p.T22K | DBIA Probe Info | |||
FTC133 | SNV: p.Q28R | . | |||
HCT116 | SNV: p.P4H | . | |||
HCT15 | SNV: p.G17C | . | |||
HT115 | SNV: p.A153T | . | |||
LNCaP clone FGC | Deletion: p.A266PfsTer4 | . | |||
MEWO | SNV: p.C304Y | DBIA Probe Info | |||
SH4 | SNV: p.K137N | . |
Probe(s) Labeling This Target
ABPP Probe
Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
---|---|---|---|---|---|
DBIA Probe Info |
![]() |
C235(2.40) | LDD3326 | [1] | |
HHS-475 Probe Info |
![]() |
Y58(0.80) | LDD0264 | [2] | |
IA-alkyne Probe Info |
![]() |
C200(1.00) | LDD2207 | [3] | |
HHS-465 Probe Info |
![]() |
N.A. | LDD2240 | [4] |
Competitor(s) Related to This Target
Competitor ID | Name | Cell line | Binding Site(Ratio) | Interaction ID | Ref |
---|---|---|---|---|---|
LDCM0116 | HHS-0101 | DM93 | Y58(0.80) | LDD0264 | [2] |
LDCM0117 | HHS-0201 | DM93 | Y58(0.55) | LDD0265 | [2] |
LDCM0118 | HHS-0301 | DM93 | Y58(0.78) | LDD0266 | [2] |
LDCM0119 | HHS-0401 | DM93 | Y58(0.65) | LDD0267 | [2] |
LDCM0120 | HHS-0701 | DM93 | Y58(1.62) | LDD0268 | [2] |
LDCM0022 | KB02 | 42-MG-BA | C235(1.17) | LDD2244 | [1] |
LDCM0023 | KB03 | A101D | C235(2.81) | LDD2667 | [1] |
LDCM0024 | KB05 | UACC62 | C235(2.40) | LDD3326 | [1] |
LDCM0628 | OTUB2-COV-1 | HEK-293T | C200(1.00) | LDD2207 | [3] |
References