Details of the Target
General Information of Target
| Target ID | LDTP13666 | |||||
|---|---|---|---|---|---|---|
| Target Name | Inhibitor of growth protein 4 (ING4) | |||||
| Gene Name | ING4 | |||||
| Gene ID | 51147 | |||||
| Synonyms |
Inhibitor of growth protein 4; p29ING4 |
|||||
| 3D Structure | ||||||
| Sequence |
MELALLCGLVVMAGVIPIQGGILNLNKMVKQVTGKMPILSYWPYGCHCGLGGRGQPKDAT
DWCCQTHDCCYDHLKTQGCSIYKDYYRYNFSQGNIHCSDKGSWCEQQLCACDKEVAFCLK RNLDTYQKRLRFYWRPHCRGQTPGC |
|||||
| Target Bioclass |
Other
|
|||||
| Family |
ING family
|
|||||
| Subcellular location |
Nucleus
|
|||||
| Function |
Component of HBO1 complexes, which specifically mediate acetylation of histone H3 at 'Lys-14' (H3K14ac), and have reduced activity toward histone H4. Through chromatin acetylation it may function in DNA replication. May inhibit tumor progression by modulating the transcriptional output of signaling pathways which regulate cell proliferation. Can suppress brain tumor angiogenesis through transcriptional repression of RELA/NFKB3 target genes when complexed with RELA. May also specifically suppress loss of contact inhibition elicited by activated oncogenes such as MYC. Represses hypoxia inducible factor's (HIF) activity by interacting with HIF prolyl hydroxylase 2 (EGLN1). Can enhance apoptosis induced by serum starvation in mammary epithelial cell line HC11.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
IA-alkyne Probe Info |
 |
N.A. | LDD0165 | [1] | |
The Interaction Atlas With This Target
The Protein(s) Related To This Target
Enzyme
| Protein name | Family | Uniprot ID | |||
|---|---|---|---|---|---|
| Peroxisomal ATPase PEX1 (PEX1) | AAA ATPase family | O43933 | |||
| Neuron navigator 2 (NAV2) | Nav/unc-53 family | Q8IVL1 | |||
Transporter and channel
| Protein name | Family | Uniprot ID | |||
|---|---|---|---|---|---|
| Huntingtin (HTT) | Huntingtin family | P42858 | |||
| Wolframin (WFS1) | . | O76024 | |||
Other