Details of the Target
General Information of Target
Target ID | LDTP13632 | |||||
---|---|---|---|---|---|---|
Target Name | Membrane-associated transporter protein (SLC45A2) | |||||
Gene Name | SLC45A2 | |||||
Gene ID | 51151 | |||||
Synonyms |
AIM1; MATP; Membrane-associated transporter protein; Melanoma antigen AIM1; Protein AIM-1; Solute carrier family 45 member 2 |
|||||
3D Structure | ||||||
Sequence |
MGQEFSWEEAEAAGEIDVAELQEWYKKFVMECPSGTLFMHEFKRFFKVTDDEEASQYVEG
MFRAFDKNGDNTIDFLEYVAALNLVLRGTLEHKLKWTFKIYDKDGNGCIDRLELLNIVEG IYQLKKACRRELQTEQGQLLTPEEVVDRIFLLVDENGDGQLSLNEFVEGARRDKWVMKML QMDMNPSSWLAQQRRKSAMF |
|||||
Target Bioclass |
Transporter and channel
|
|||||
Family |
Glycoside-pentoside-hexuronide (GPH) cation symporter transporter (TC 2.A.2) family
|
|||||
Subcellular location |
Melanosome membrane
|
|||||
Function |
Proton-associated glucose and sucrose transporter. May be able to transport also fructose. Expressed at a late melanosome maturation stage where functions as proton/glucose exporter which increase lumenal pH by decreasing glycolysis. Regulates melanogenesis by maintaining melanosome neutralization that is initially initiated by transient OCA2 and required for a proper function of the tyrosinase TYR.
|
|||||
Uniprot ID | ||||||
Ensemble ID | ||||||
HGNC ID |
Target Site Mutations in Different Cell Lines
Cell line | Mutation details | Probe for labeling this protein in this cell | |||
---|---|---|---|---|---|
DU145 | SNV: p.V111F | . | |||
HCT15 | SNV: p.S39G | . | |||
HT115 | SNV: p.K289N | . | |||
HUH7 | Insertion: p.V144KfsTer11 | . | |||
IGR1 | SNV: p.T108I; p.P315S | DBIA Probe Info | |||
MCC13 | SNV: p.G269S | . | |||
NCIH1792 | SNV: p.G396E | . | |||
TE10 | SNV: p.E26Ter | . | |||
TYKNU | SNV: p.A124D | . | |||
U937 | SNV: p.S90Ter | . |
Probe(s) Labeling This Target
ABPP Probe
Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
---|---|---|---|---|---|
DBIA Probe Info |
![]() |
C171(2.58) | LDD3413 | [1] |
Competitor(s) Related to This Target