General Information of Target

Target ID LDTP13611
Target Name ALK tyrosine kinase receptor (ALK)
Gene Name ALK
Gene ID 238
Synonyms
ALK tyrosine kinase receptor; EC 2.7.10.1; Anaplastic lymphoma kinase; CD antigen CD246
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MATFPCQLCGKTFLTLEKFTIHNYSHSRERPYKCVQPDCGKAFVSRYKLMRHMATHSPQK
SHQCAHCEKTFNRKDHLKNHLQTHDPNKMAFGCEECGKKYNTMLGYKRHLALHAASSGDL
TCGVCALELGSTEVLLDHLKAHAEEKPPSGTKEKKHQCDHCERCFYTRKDVRRHLVVHTG
CKDFLCQFCAQRFGRKDHLTRHTKKTHSQELMKESLQTGDLLSTFHTISPSFQLKAAALP
PFPLGASAQNGLASSLPAEVHSLTLSPPEQAAQPMQPLPESLASLHPSVSPGSPPPPLPN
HKYNTTSTSYSPLASLPLKADTKGFCNISLFEDLPLQEPQSPQKLNPGFDLAKGNAGKVN
LPKELPADAVNLTIPASLDLSPLLGFWQLPPPATQNTFGNSTLALGPGESLPHRLSCLGQ
QQQEPPLAMGTVSLGQLPLPPIPHVFSAGTGSAILPHFHHAFR
Target Type
Successful
Target Bioclass
Enzyme
Family
Protein kinase superfamily, Tyr protein kinase family, Insulin receptor subfamily
Subcellular location
Cell membrane
Function
Neuronal receptor tyrosine kinase that is essentially and transiently expressed in specific regions of the central and peripheral nervous systems and plays an important role in the genesis and differentiation of the nervous system. Also acts as a key thinness protein involved in the resistance to weight gain: in hypothalamic neurons, controls energy expenditure acting as a negative regulator of white adipose tissue lipolysis and sympathetic tone to fine-tune energy homeostasis. Following activation by ALKAL2 ligand at the cell surface, transduces an extracellular signal into an intracellular response. In contrast, ALKAL1 is not a potent physiological ligand for ALK. Ligand-binding to the extracellular domain induces tyrosine kinase activation, leading to activation of the mitogen-activated protein kinase (MAPK) pathway. Phosphorylates almost exclusively at the first tyrosine of the Y-x-x-x-Y-Y motif. Induces tyrosine phosphorylation of CBL, FRS2, IRS1 and SHC1, as well as of the MAP kinases MAPK1/ERK2 and MAPK3/ERK1. ALK activation may also be regulated by pleiotrophin (PTN) and midkine (MDK). PTN-binding induces MAPK pathway activation, which is important for the anti-apoptotic signaling of PTN and regulation of cell proliferation. MDK-binding induces phosphorylation of the ALK target insulin receptor substrate (IRS1), activates mitogen-activated protein kinases (MAPKs) and PI3-kinase, resulting also in cell proliferation induction. Drives NF-kappa-B activation, probably through IRS1 and the activation of the AKT serine/threonine kinase. Recruitment of IRS1 to activated ALK and the activation of NF-kappa-B are essential for the autocrine growth and survival signaling of MDK.
TTD ID
T56418
Uniprot ID
Q9UM73
DrugMap ID
TTPMQSO
Ensemble ID
ENST00000389048.8
HGNC ID
HGNC:427
ChEMBL ID
CHEMBL4247

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 2 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
DBIA
 Probe Info 
C1182(2.25); C1354(2.34)  LDD3311  [1]
Acrolein
 Probe Info 
N.A.  LDD0221  [2]

Competitor(s) Related to This Target

Competitor ID Name Cell line Binding Site(Ratio) Interaction ID Ref
 LDCM0108  Chloroacetamide HeLa N.A.  LDD0222  [2]
 LDCM0107  IAA HeLa N.A.  LDD0221  [2]
 LDCM0022  KB02 DEL C1182(2.47); C1539(2.19); C1365(2.03); C1354(2.50)  LDD2315  [1]
 LDCM0023  KB03 DEL C1182(5.01); C1539(3.30); C1365(3.75); C1354(3.49)  LDD2732  [1]
 LDCM0024  KB05 G361 C1182(2.25); C1354(2.34)  LDD3311  [1]
 LDCM0109  NEM HeLa N.A.  LDD0223  [2]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Enzyme
Click To Hide/Show 3 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Proto-oncogene tyrosine-protein kinase receptor Ret (RET) Tyr protein kinase family P07949
ALK tyrosine kinase receptor (ALK) Tyr protein kinase family Q9UM73
Receptor-type tyrosine-protein phosphatase zeta (PTPRZ1) Protein-tyrosine phosphatase family P23471
Transporter and channel
Click To Hide/Show 1 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Heat shock protein HSP 90-beta (HSP90AB1) Heat shock protein 90 family P08238
Other
Click To Hide/Show 2 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
ALK and LTK ligand 1 (ALKAL1) ALKAL family Q6UXT8
ALK and LTK ligand 2 (ALKAL2) ALKAL family Q6UX46

The Drug(s) Related To This Target

Approved
Click To Hide/Show 8 Drug(s) Interacting with This Target
Drug Name Drug Type External ID
Alectinib Small molecular drug D0U3SY
Brigatinib Small molecular drug D08PIE
Ceritinib Small molecular drug D04LVK
Crizotinib Small molecular drug D03ZBT
Entrectinib Small molecular drug D0O0LS
Fostamatinib Small molecular drug DB12010
Gilteritinib Small molecular drug DB12141
Lorlatinib . D0AF6O
Phase 3
Click To Hide/Show 1 Drug(s) Interacting with This Target
Drug Name Drug Type External ID
Ensartinib . D0KX7I
Phase 2
Click To Hide/Show 5 Drug(s) Interacting with This Target
Drug Name Drug Type External ID
Ap26113 Small molecular drug D0O9PQ
Pf-06463922 Small molecular drug D04DYC
X-396 Small molecular drug D0L9PA
Tpx-0005 . D05NFR
Tsr-011 . D01HKZ
Phase 1
Click To Hide/Show 1 Drug(s) Interacting with This Target
Drug Name Drug Type External ID
Asp3026 Small molecular drug D09GEK
Investigative
Click To Hide/Show 13 Drug(s) Interacting with This Target
Drug Name Drug Type External ID
Dlx-521 Antibody D0D2SU
Atp Small molecular drug DB00171
Azd3463 Small molecular drug D0O7LU
Cep-28122 Small molecular drug D09PTP
Gsk-1838705a Small molecular drug D06PJW
Pmid20483621c5g Small molecular drug D0H0LP
Pmid20483621c5m Small molecular drug D02NZE
Pmid20483621c5n Small molecular drug D08TVU
Pmid22564207c25b Small molecular drug D09AID
Pmid24432909c8e Small molecular drug D0K5UF
Pmid24900237c15 Small molecular drug D0G4CS
Cep-18050 . D03IDK
Crl-37212 . D0I3TD
Patented
Click To Hide/Show 4 Drug(s) Interacting with This Target
Drug Name Drug Type External ID
1,2,4-triazolo[1,5a]Pyridine Derivative 2 Small molecular drug D0NP2W
Benzimidazole Derivative 6 Small molecular drug D0T3TZ
Carboxamide Derivative 4 Small molecular drug D0MX7B
Pmid28270010-compound-figure21-b Small molecular drug D0N8YJ

References

1 DrugMap: A quantitative pan-cancer analysis of cysteine ligandability. Cell. 2024 May 9;187(10):2536-2556.e30. doi: 10.1016/j.cell.2024.03.027. Epub 2024 Apr 22.
Mass spectrometry data entry: PXD047840
2 ACR-Based Probe for the Quantitative Profiling of Histidine Reactivity in the Human Proteome. J Am Chem Soc. 2023 Mar 8;145(9):5252-5260. doi: 10.1021/jacs.2c12653. Epub 2023 Feb 27.