Details of the Target
General Information of Target
| Target ID | LDTP13598 | |||||
|---|---|---|---|---|---|---|
| Target Name | Matrix metalloproteinase-17 (MMP17) | |||||
| Gene Name | MMP17 | |||||
| Gene ID | 4326 | |||||
| Synonyms |
MT4MMP; Matrix metalloproteinase-17; MMP-17; EC 3.4.24.-; Membrane-type matrix metalloproteinase 4; MT-MMP 4; MTMMP4; Membrane-type-4 matrix metalloproteinase; MT4-MMP; MT4MMP |
|||||
| 3D Structure | ||||||
| Sequence |
MGRARDAILDALENLTAEELKKFKLKLLSVPLREGYGRIPRGALLSMDALDLTDKLVSFY
LETYGAELTANVLRDMGLQEMAGQLQAATHQGSGAAPAGIQAPPQSAAKPGLHFIDQHRA ALIARVTNVEWLLDALYGKVLTDEQYQAVRAEPTNPSKMRKLFSFTPAWNWTCKDLLLQA LRESQSYLVEDLERS |
|||||
| Target Type |
Literature-reported
|
|||||
| Target Bioclass |
Enzyme
|
|||||
| Family |
Peptidase M10A family
|
|||||
| Subcellular location |
Cell membrane
|
|||||
| Function |
Endopeptidase that degrades various components of the extracellular matrix, such as fibrin. May be involved in the activation of membrane-bound precursors of growth factors or inflammatory mediators, such as tumor necrosis factor-alpha. May also be involved in tumoral process. Cleaves pro-TNF-alpha at the '74-Ala-|-Gln-75' site. Not obvious if able to proteolytically activate progelatinase A. Does not hydrolyze collagen types I, II, III, IV and V, gelatin, fibronectin, laminin, decorin nor alpha1-antitrypsin.
|
|||||
| TTD ID | ||||||
| Uniprot ID | ||||||
| DrugMap ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
| ChEMBL ID | ||||||
Target Site Mutations in Different Cell Lines
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
NAIA_4 Probe Info |
![]() |
N.A. | LDD2226 | [1] | |

