Details of the Target
General Information of Target
| Target ID | LDTP13586 | |||||
|---|---|---|---|---|---|---|
| Target Name | Ras-related protein Rab-26 (RAB26) | |||||
| Gene Name | RAB26 | |||||
| Gene ID | 25837 | |||||
| Synonyms |
Ras-related protein Rab-26 |
|||||
| 3D Structure | ||||||
| Sequence |
MEAEESEKAATEQEPLEGTEQTLDAEEEQEESEEAACGSKKRVVPGIVYLGHIPPRFRPL
HVRNLLSAYGEVGRVFFQAEDRFVRRKKKAAAAAGGKKRSYTKDYTEGWVEFRDKRIAKR VAASLHNTPMGARRRSPFRYDLWNLKYLHRFTWSHLSEHLAFERQVRRQRLRAEVAQAKR ETDFYLQSVERGQRFLAADGDPARPDGSWTFAQRPTEQELRARKAARPGGRERARLATAQ DKARSNKGLLARIFGAPPPSESMEGPSLVRDS |
|||||
| Target Bioclass |
Enzyme
|
|||||
| Family |
Small GTPase superfamily, Rab family
|
|||||
| Subcellular location |
Golgi apparatus membrane
|
|||||
| Function |
The small GTPases Rab are key regulators of intracellular membrane trafficking, from the formation of transport vesicles to their fusion with membranes. Rabs cycle between an inactive GDP-bound form and an active GTP-bound form that is able to recruit to membranes different set of downstream effectors directly responsible for vesicle formation, movement, tethering and fusion. Mediates transport of ADRA2A and ADRA2B from the Golgi to the cell membrane. Plays a role in the maturation of zymogenic granules and in pepsinogen secretion in the stomach. Plays a role in the secretion of amylase from acinar granules in the parotid gland.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Target Site Mutations in Different Cell Lines
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
DBIA Probe Info |
![]() |
C78(1.67) | LDD2265 | [1] | |
|
TFBX Probe Info |
![]() |
N.A. | LDD0027 | [2] | |
Competitor(s) Related to This Target
The Interaction Atlas With This Target
The Protein(s) Related To This Target
GPCR
| Protein name | Family | Uniprot ID | |||
|---|---|---|---|---|---|
| Alpha-2B adrenergic receptor (ADRA2B) | G-protein coupled receptor 1 family | P18089 | |||
Other
References


