Details of the Target
General Information of Target
| Target ID | LDTP13561 | |||||
|---|---|---|---|---|---|---|
| Target Name | Plexin-B3 (PLXNB3) | |||||
| Gene Name | PLXNB3 | |||||
| Gene ID | 5365 | |||||
| Synonyms |
KIAA1206; PLXN6; Plexin-B3 |
|||||
| 3D Structure | ||||||
| Sequence |
MDTESQYSGYSYKSGHSRSSRKHRDRRDRHRSKSRDGGRGDKSVTIQAPGEPLLDNESTR
GDERDDNWGETTTVVTGTSEHSISHDDLTRIAKDMEDSVPLDCSRHLGVAAGATLALLSF LTPLAFLLLPPLLWREELEPCGTACEGLFISVAFKLLILLLGSWALFFRRPKASLPRVFV LRALLMVLVFLLVVSYWLFYGVRILDARERSYQGVVQFAVSLVDALLFVHYLAVVLLELR QLQPQFTLKVVRSTDGASRFYNVGHLSIQRVAVWILEKYYHDFPVYNPALLNLPKSVLAK KVSGFKVYSLGEENSTNNSTGQSRAVIAAAARRRDNSHNEYYYEEAEHERRVRKRRARLV VAVEEAFTHIKRLQEEEQKNPREVMDPREAAQAIFASMARAMQKYLRTTKQQPYHTMESI LQHLEFCITHDMTPKAFLERYLAAGPTIQYHKERWLAKQWTLVSEEPVTNGLKDGIVFLL KRQDFSLVVSTKKVPFFKLSEEFVDPKSHKFVMRLQSETSV |
|||||
| Target Bioclass |
Other
|
|||||
| Family |
Plexin family
|
|||||
| Subcellular location |
Cell membrane
|
|||||
| Function |
Receptor for SEMA5A that plays a role in axon guidance, invasive growth and cell migration. Stimulates neurite outgrowth and mediates Ca(2+)/Mg(2+)-dependent cell aggregation. In glioma cells, SEMA5A stimulation of PLXNB3 results in the disassembly of F-actin stress fibers, disruption of focal adhesions and cellular collapse as well as inhibition of cell migration and invasion through ARHGDIA-mediated inactivation of RAC1.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Target Site Mutations in Different Cell Lines
| Cell line | Mutation details | Probe for labeling this protein in this cell | |||
|---|---|---|---|---|---|
| A204 | SNV: p.Q109K | . | |||
| HCT15 | SNV: p.R1579H | . | |||
| HT115 | SNV: p.V1571L | . | |||
| Ishikawa (Heraklio) 02 ER | SNV: p.N707T | . | |||
| JURKAT | SNV: p.V263M | . | |||
| KYSE150 | SNV: p.D794H | . | |||
| MCC13 | SNV: p.P1343S | . | |||
| MEWO | SNV: p.P1015S | DBIA Probe Info | |||
| MOLM16 | SNV: p.V962M | . | |||
| MOLT4 | SNV: p.D1546N; p.Q1704Ter; p.P1767T | . | |||
| NCIH1793 | SNV: p.Q585K | . | |||
| NCIH716 | SNV: p.D1360A | . | |||
| OCIAML2 | SNV: p.P108Q | . | |||
| RKO | SNV: p.A579T | . | |||
| SKMEL2 | SNV: p.Q920Ter | . | |||
| SNU1 | SNV: p.A292T | DBIA Probe Info | |||
| SNU869 | SNV: p.L484I | . | |||
| SW403 | SNV: p.P1689Q; p.E1881D | . | |||
| TOV21G | SNV: p.Q1069H | . | |||
| WM2664 | Insertion: p.E698GfsTer74 | DBIA Probe Info | |||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
DBIA Probe Info |
![]() |
C163(1.20) | LDD3316 | [1] | |
Competitor(s) Related to This Target

